KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0518Help
Entry
PSPTO_0518        CDS       T00118                                 

Definition
tryptophan 2-monooxygenase
Orthology
K00466  
tryptophan 2-monooxygenase [EC:1.13.12.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Tryptophan metabolism
Class
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:pst00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(565932..567566)
Genome map
AA seq 544 aa AA seqDB search
MFGPDFPFAFDDWIEHPKGLGSIPAEHHGAEVAIIGAGIAGLVAAYELMKMGLKPVVYEA
SKMGGRLRSQEFEGAKGIVAELGGMRFPVSSTAFFHYVDKLGLESRPFPNPLTAASGSTV
IDLEGTTYYAQMLSDLPALFQEVADAWADALESGSQFGDIQQAIRDRDVPRLKELWNKLV
PLWDDRTFYDFVATSKAFAKLSFYHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDE
HQHLIVGGVQQVPVGLWSHVPERCTHWPKGTSLSSLHRGAPRPGVKRIARAEDGSFAVTD
NWGDTRQYAAVLTTCQSWLLTTQIECEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWK
DKDPQTGRDLMSMTLTDRLTRGTYLFDNGDDKPGVICLSYSWMSDALKMLPQPIEKRVKL
ALDALKKIYPKVDIAARIIGDPITVSWEADPHFLGAFKGALPGHYRYNQRMYAHFMQQDM
PSEQRGMFIAGDDVSWTPAWVEGAVQTSLNAVWGIMNHFGGKTHAENPGPGDVFHEIGPI
TLAD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgttcggccctgatttcccctttgccttcgatgactggatcgagcacccgaagggtctg
ggcagcattccggctgaacatcatggcgcagaagtggcgattatcggcgccggtattgcc
gggctggtagcggcttacgaattgatgaagatgggcctcaaacccgtggtgtatgaagcc
tccaagatgggcggccgtctgcgctcgcaggagttcgaaggcgccaaaggcatcgttgca
gaattgggcggcatgcgcttcccggtgtcatcgacggcgttctttcactacgtcgacaag
ctgggccttgagtccaggccgtttcccaacccgctgacggccgcctccggcagcacggtc
atcgacctggaaggcaccacttattacgcgcagatgctatcggacctgccagccctgttt
caggaagtcgccgatgcctgggccgacgcactggaaagcggctcgcagttcggtgacatc
cagcaagccatccgcgaccgtgatgtgccgcgtctcaaggagctgtggaacaagctggtg
ccgttgtgggacgaccgcaccttctatgacttcgtcgcgacgtccaaggcgttcgccaaa
ctgtccttctatcatcgcgaagtgtttggccaggtcggtttcggcactggcggctgggat
tcggacttccccaattcgatgctggaaatcttccgcgtggtgatgaccaactgcgatgag
caccagcacctgatcgtcggcggcgtgcagcaagtgccggtcgggttatggagccacgtg
cccgagcgttgcacccattggccgaagggcaccagcctgtcttcgttacatcgtggcgcg
cctcgccccggcgtgaagcgcattgcgcgagccgaggatggaagctttgccgtgaccgac
aactggggcgacacccggcaatacgccgccgtgctgaccacctgccaaagctggctgctg
accacccagatcgagtgcgaggaatcgctgttctcgcaaaagatgtggatggccctggac
cgcacccgttacatgcagtcgtcgaagacgttcgtcatggtcgaccggccgttctggaaa
gacaaggacccgcaaaccggtcgcgacctgatgagcatgaccctcaccgaccgattgacc
cgtggcacttatctgttcgataacggcgacgacaagccgggggtgatctgcctgtcctac
tcgtggatgagcgatgcactgaagatgctgccgcaacccatcgagaagcgcgtgaagctg
gcgctcgatgcgctgaaaaagatttacccgaaagtggacatcgcggcgcgcatcatcggc
gatccgatcaccgtttcgtgggaagccgatccgcacttcctcggcgcgttcaagggtgcg
cttccgggccattaccgctacaaccagcgcatgtacgcgcacttcatgcagcaggacatg
cccagcgaacagcgcggcatgttcatcgccggtgacgatgtgtcctggacgccagcctgg
gtagaaggcgcggtgcagacgtcgctgaatgcggtatggggcatcatgaatcactttggc
ggcaagactcacgctgaaaacccgggccccggcgatgtattccacgaaatcggcccgatc
acgctggctgactga

DBGET integrated database retrieval system