KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0518Help
Entry
PSPTO_0518        CDS       T00118                                 

Definition
tryptophan 2-monooxygenase
Orthology
K00466  
tryptophan 2-monooxygenase [EC:1.13.12.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    PSPTO_0518
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.3  tryptophan 2-monooxygenase
     PSPTO_0518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(565932..567566)
Genome map
AA seq 544 aa AA seqDB search
MFGPDFPFAFDDWIEHPKGLGSIPAEHHGAEVAIIGAGIAGLVAAYELMKMGLKPVVYEA
SKMGGRLRSQEFEGAKGIVAELGGMRFPVSSTAFFHYVDKLGLESRPFPNPLTAASGSTV
IDLEGTTYYAQMLSDLPALFQEVADAWADALESGSQFGDIQQAIRDRDVPRLKELWNKLV
PLWDDRTFYDFVATSKAFAKLSFYHREVFGQVGFGTGGWDSDFPNSMLEIFRVVMTNCDE
HQHLIVGGVQQVPVGLWSHVPERCTHWPKGTSLSSLHRGAPRPGVKRIARAEDGSFAVTD
NWGDTRQYAAVLTTCQSWLLTTQIECEESLFSQKMWMALDRTRYMQSSKTFVMVDRPFWK
DKDPQTGRDLMSMTLTDRLTRGTYLFDNGDDKPGVICLSYSWMSDALKMLPQPIEKRVKL
ALDALKKIYPKVDIAARIIGDPITVSWEADPHFLGAFKGALPGHYRYNQRMYAHFMQQDM
PSEQRGMFIAGDDVSWTPAWVEGAVQTSLNAVWGIMNHFGGKTHAENPGPGDVFHEIGPI
TLAD
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgttcggccctgatttcccctttgccttcgatgactggatcgagcacccgaagggtctg
ggcagcattccggctgaacatcatggcgcagaagtggcgattatcggcgccggtattgcc
gggctggtagcggcttacgaattgatgaagatgggcctcaaacccgtggtgtatgaagcc
tccaagatgggcggccgtctgcgctcgcaggagttcgaaggcgccaaaggcatcgttgca
gaattgggcggcatgcgcttcccggtgtcatcgacggcgttctttcactacgtcgacaag
ctgggccttgagtccaggccgtttcccaacccgctgacggccgcctccggcagcacggtc
atcgacctggaaggcaccacttattacgcgcagatgctatcggacctgccagccctgttt
caggaagtcgccgatgcctgggccgacgcactggaaagcggctcgcagttcggtgacatc
cagcaagccatccgcgaccgtgatgtgccgcgtctcaaggagctgtggaacaagctggtg
ccgttgtgggacgaccgcaccttctatgacttcgtcgcgacgtccaaggcgttcgccaaa
ctgtccttctatcatcgcgaagtgtttggccaggtcggtttcggcactggcggctgggat
tcggacttccccaattcgatgctggaaatcttccgcgtggtgatgaccaactgcgatgag
caccagcacctgatcgtcggcggcgtgcagcaagtgccggtcgggttatggagccacgtg
cccgagcgttgcacccattggccgaagggcaccagcctgtcttcgttacatcgtggcgcg
cctcgccccggcgtgaagcgcattgcgcgagccgaggatggaagctttgccgtgaccgac
aactggggcgacacccggcaatacgccgccgtgctgaccacctgccaaagctggctgctg
accacccagatcgagtgcgaggaatcgctgttctcgcaaaagatgtggatggccctggac
cgcacccgttacatgcagtcgtcgaagacgttcgtcatggtcgaccggccgttctggaaa
gacaaggacccgcaaaccggtcgcgacctgatgagcatgaccctcaccgaccgattgacc
cgtggcacttatctgttcgataacggcgacgacaagccgggggtgatctgcctgtcctac
tcgtggatgagcgatgcactgaagatgctgccgcaacccatcgagaagcgcgtgaagctg
gcgctcgatgcgctgaaaaagatttacccgaaagtggacatcgcggcgcgcatcatcggc
gatccgatcaccgtttcgtgggaagccgatccgcacttcctcggcgcgttcaagggtgcg
cttccgggccattaccgctacaaccagcgcatgtacgcgcacttcatgcagcaggacatg
cccagcgaacagcgcggcatgttcatcgccggtgacgatgtgtcctggacgccagcctgg
gtagaaggcgcggtgcagacgtcgctgaatgcggtatggggcatcatgaatcactttggc
ggcaagactcacgctgaaaacccgggccccggcgatgtattccacgaaatcggcccgatc
acgctggctgactga

DBGET integrated database retrieval system