KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0778Help
Entry
PSPTO_0778        CDS       T00118                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pst00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSPTO_0778 (recD)
Enzymes [BR:pst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     PSPTO_0778 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
840139..842232
Genome map
AA seq 697 aa AA seqDB search
MSRSFDDLLPTALDDISLADLSPLTRADDLLMLLERWVERGWLRALDRAFVAFLSDLDPQ
ADPLVLVAAALTSHQLGHGHVCLDLYETLKEPDFALSLPPEGDQQDGAMLLPSQLLAALD
GAAWCQALARSMLVAQATDSSAEALQKPLVLAERRLYLRRYWTYERRIAAALRRRLEQAD
APPDDLPQRLNALFGPANSAPDAIIDWQKLACALATRRAFSIITGGPGTGKTTTVVRLLA
LLQAPAVQSGQPLRIRLAAPTGKAAARLTESISQQVQSLDVSAEVRQKIPSEVTTVHRLL
GSRPGTRHFRHHAGNLLPLDVLVVDEASMIDLEMMANLLDALPPHARMVLLGDKDQLASV
EAGAVLGDLCRDAEDGFYSPQTQTWLEAVSGEDLSKGTLRQGDAQQHPLAQQVVMLRHSR
RFGQGSGIGQLARLVNQQQDQQARALLSAGSHTDLFALALKGEQDLKFERLVLEGLGQGE
QGPQGYRHYLNVLGAERPAVGAELDDECWTRWARSVLDAFDSFQLLCAVRKGPWGVEGLN
QRITHALFNAQLIESDQQWYEGRPVLMTHNDYGLGLMNGDIGITLRLPERDGEGKQVLRV
AFPRNDGSGGVRFVLPSRLNEVETVYAMTVHKSQGSEFAHTALILPEALNPVLTKELIYT
GITRAKHWFSLIEPRQGIFEEALRRKVKRLSGLMLGL
NT seq 2094 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttcgttcgacgatctgttgcccactgcgctggacgacatcagcctcgccgac
ttgagcccgttgacccgcgccgacgatctgctgatgctgctggaacgctgggtcgagcgc
ggttggttgcgcgccctggaccgggcttttgtcgcgttcctcagcgacctcgacccgcag
gccgatccactggtgctggtcgctgcggccctcaccagccatcaactgggccacggccat
gtctgcctcgatctttacgagaccttgaaagagccggacttcgccttgtcactgccgccc
gaaggtgatcagcaagacggggcaatgctgctgccctcgcaattgctggcagcgctggat
ggcgcagcgtggtgccaggcgctggcgcgcagcatgctggtcgcgcaagccacagactca
agcgccgaggcgctgcaaaaacccttagtgctggcagaacgacgtttgtacctgcgccgc
tactggacctacgaacgccgcatcgctgcagccctgcgtcggcgtctggagcaagccgat
gctccgcccgacgatctgccgcagcgcctgaacgctttgttcgggcctgcgaactcagcg
ccggacgccatcatcgactggcagaaactggcctgcgcactggcaacccgccgggcattc
agcatcatcaccggcggccccggcacgggcaaaaccaccaccgtggtgcgcttgctggcg
ttgcttcaggctcctgccgtgcagagcggccagccgctgcgcattcgtttggcagcgccg
accggcaaggcggcagcacgtctgaccgaatccatcagccagcaagtgcaaagcctggac
gtcagcgccgaggtgcggcagaaaatccccagtgaagtcaccaccgtgcaccgcttgctg
ggcagccgccctggcacgcgccatttccgtcaccacgcaggtaacttgctgccactggac
gtgctggtcgtcgacgaagcgtccatgatcgacctggaaatgatggccaacctgctcgac
gcactgccgccgcacgcgcgcatggttctgctcggcgacaaagaccaattggcttccgtc
gaggcgggcgcggtactgggtgatttgtgtcgcgacgccgaagacggcttctacagcccg
caaacccagacctggctcgaagctgtcagcggcgaagacctcagcaaaggcacattgcgc
caaggcgatgcgcagcaacatccactggcccaacaagtggtcatgctgcgccactcgcgc
cgttttggccaaggcagcggcatcggccagttggcccggctggtcaaccagcaacaggat
caacaggcgagggcgctgctgtcggcaggcagtcacaccgatctgttcgccctggcgctc
aagggcgagcaagacctcaagttcgagcggctggtgctggaaggccttggccaaggcgag
caaggcccgcagggttataggcattacctgaacgtgctcggcgccgagcgcccggcagtc
ggcgctgaactggacgatgaatgttggacccgatgggcacgctcggtactcgacgccttc
gactcgttccagttgctctgcgctgtacgcaaaggcccgtggggcgtagaaggccttaac
caacgcatcacccatgcgttattcaatgcgcagctgatcgaaagcgatcagcagtggtac
gaaggccggccagtcctgatgacccacaacgactacggcctgggcttgatgaacggcgac
atcggcatcaccttgcgattgcccgagcgcgatggcgagggcaaacaggtcctgcgcgtc
gccttcccgcgcaacgatggcagcggcggcgtgcgcttcgtcctgcccagccgcctcaac
gaagtcgaaaccgtctacgccatgaccgtgcataaatcccaaggctcggaattcgcccac
accgccctgattctgcccgaagccctcaacccggtactgaccaaagaactcatctacacc
ggcatcacccgcgccaaacactggttcagcctgatcgaaccgcgccagggcatcttcgag
gaagccctgcgccgcaaagtcaaacgcctgagcggcttgatgctcgggctttga

DBGET integrated database retrieval system