KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0908Help
Entry
PSPTO_0908        CDS       T00118                                 

Gene name
cheB-1
Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pst00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPTO_0908 (cheB-1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    PSPTO_0908 (cheB-1)
Enzymes [BR:pst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSPTO_0908 (cheB-1)
Two-component system [BR:pst02022]
 CheA family
  CheA-CheYBV
   PSPTO_0908 (cheB-1)
Bacterial motility proteins [BR:pst02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    PSPTO_0908 (cheB-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(989768..990844)
Genome map
AA seq 358 aa AA seqDB search
MPGKKISVLLVDDSAVVRQVLVAILNETPDIHVMAAASDPIFAMGKLAHEWPDVIVLDVE
MPRMDGITFLKKIMSERPTPVVICSSLTQKGAETSLQALSAGAVEIITKPTTGLKNFLIE
SAAELVAAIRAAANSNVKNLGKRTATPVLTPASKLTADAILPAASGHSMAQTTERIVAIG
TSTGGTQALEAVLTALPRVCPGIVIVQHMPEKFTASFAERLNGLSQIEVREARNNDRILP
GLALIAPGGKHMMVTRSGAYYHVQVIDGPLVNRHRPSVDVLFRSVARFAGKNATGIIMTG
MGDDGARGLKEMLDAGSSTVAQDEASCVVFGMPKEAIKLNAAQRIMPLQEIHQAILHR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccaggtaaaaaaatcagcgtgctgctggtcgatgactcggcggtggttcgtcaggtc
cttgtggcaatcctcaatgaaacgccggacatccacgtcatggcagcggcgtccgatccg
atatttgccatgggcaaacttgcccacgaatggccggatgtgattgtgctggacgtggaa
atgccgcgcatggacggcatcacgttcctgaaaaaaatcatgagcgagcgaccgacgccc
gtggtgatctgctcgtcgctgacccagaaaggcgcggaaacctcgttacaggcgctgtct
gcaggagccgtggagatcatcaccaaacccacgacgggtcttaaaaactttctgatcgag
tcagccgccgagctggtcgccgccattcgcgcggcggcgaactccaacgtgaaaaacctc
ggcaagcgcacagccacaccggtactgacaccggccagcaaactcaccgcagatgccatt
ttgcctgcagccagcggtcactcgatggcccagaccaccgaacgcatcgtcgccattggc
acctcgacgggcggcacgcaggcgctggaagcggtgttgacagcgctgcccagagtctgc
ccgggcatcgtcatcgttcagcacatgccggaaaaattcaccgcctcgttcgccgaacgc
ctcaacggcttgtcgcagatcgaagtgcgtgaagccagaaacaacgaccgcatcctgccc
ggcctggccctgatcgcacccggcggcaagcacatgatggtaacgcgcagcggcgcctat
tatcacgtccaggtcatcgacggcccgctggtcaatcggcaccgcccatcggtggacgtg
ctgttccgctcggtggccaggttcgccggcaagaacgccaccggcatcatcatgaccggc
atgggcgacgacggcgcacgcggcctcaaggaaatgctcgacgcaggcagctcgaccgtc
gcccaggacgaagccagctgcgtggtgttcggcatgcccaaggaagccatcaaactcaat
gctgcgcaaagaatcatgcccttgcaggagattcatcaggcgattttgcaccgataa

DBGET integrated database retrieval system