KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_0962Help
Entry
PSPTO_0962        CDS       T00118                                 

Gene name
folK-2
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pst00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1044547..1045053)
Genome map
AA seq 168 aa AA seqDB search
MSKPLLTTERVYIGLGSNLADPAEQLRSALKALAQLPDSTLIGVSSFYVSDSLLPGQPRF
TNAVAALDTTLPPLALLDALQAIELDQGRERHERWGPRTLDLDILLFGERVMDEPRLKVP
HYHMQARAFVLYPLAELAPELTLADGRELTHLLSECPFTGLERLPASV
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaccgctgttgaccaccgaacgcgtttacattggcctgggcagcaaccttgct
gacccggccgagcaattgcgcagcgccctcaaggcgctggcgcaactgccagacagcacg
ctgattggcgtgtcttcgttctatgtcagcgactcgctgctgcccggtcaaccgcgcttt
accaatgccgtcgccgcgctggacaccaccctgccaccgctggcactgcttgatgcgtta
caggccatcgagctggatcagggccgtgaacgtcacgaacgctgggggccgcgcaccctg
gacctcgatattctgctgttcggcgaacgagtcatggacgagccacgcctcaaggtgccg
cactatcacatgcaggcacgcgcattcgtgttgtacccgctggctgagctggcaccagag
ctgaccctggccgacgggcgtgagctgacccacctgttgagtgaatgcccgtttacaggt
cttgagcgcctgcccgccagcgtatga

DBGET integrated database retrieval system