KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1010Help
Entry
PSPTO_1010        CDS       T00118                                 

Gene name
phoD
Definition
alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:pst00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:pst00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:pst02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1103683..1105254)
Genome map
AA seq 523 aa AA seqDB search
MTDFNPDRRRIITGVAGATLLSILSPFARSAGVDYPFTLGVSSGDPLPDGFVIWTRLAPQ
VITPAGDGGLSKAVEVRWKIASDAAMTRIVRSGQATAQSRFAHSVHVEVSGLQPGRPYWY
QFESLGAQSPVGQACTAPPATAMAAARFGFVSCSHWEAGYFSAYRHLAAERPDLVFFLGD
YIYEANVSPANTQFPRRHATSDPIDLAGYRNRYAQYKTDPDLQALHACAPSVVTWDDHEV
QNDYAAQWSQDPSVPVESFLRRRAAAYQAFYEHMPLRASSLPKGPNMRIYRNLDYGRLAR
FHVLDGRQYRSEQACIQANGSRRGYVAPSDCTDLSDPKRTMLGWEQEAWLDRSFAESPGQ
WNVIAQDLLVAPLEQRNLKTQALGHWTDGWDGYAATRERMLASLQRHQTRNPVFWGGDIH
SFWTTDLHADAGNPDSAVVATEFVGTSVTSGGPPFEAFNSILGLNPHVKFFDSRQRGYVA
VDLSEQQMLTRFQVVSDVLDPAASVSTLKRFAVEAGKAGAVPV
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaatccggaccgccgccgcatcattaccggcgtggccggggccacactg
ctgtcgatcctcagcccgtttgcacgcagtgctggtgtcgattatccgttcacactgggc
gtgtcgtcaggcgatccgttgccggacggcttcgtgatctggacacgtcttgccccccag
gtgatcaccccggcaggcgacggtggcttgagcaaagccgtcgaggtgcgctggaaaatc
gccagcgacgccgccatgacgcgcatcgtgcgctcgggccaagccaccgcccagtcacgc
tttgcgcattcggtgcacgttgaagtgagcggcttgcaaccggggcggccctattggtat
cagttcgaaagcctgggcgcacaaagcccggtgggtcaggcctgcacggccccacccgcg
acggccatggctgcggcgaggttcggctttgtatcgtgctcgcattgggaagccgggtat
ttcagcgcctatcggcacctggctgcggagcgaccggatctggtgttctttctcggtgac
tatatctatgaagcaaacgtttctcccgcgaatacacagttcccacgccgccacgccaca
tcagacccgatagatctggctggctatcgcaaccgatacgcgcaatacaagaccgacccg
gacctgcaagccctgcatgcctgcgcgccaagcgttgtcacctgggacgatcacgaagtg
cagaatgactatgccgcgcagtggtctcaagaccccagcgttccggtagagagctttctg
cgtcgcagagccgccgcttatcaggcgttttacgagcacatgccgttgcgcgccagcagt
ttgcccaaaggtcccaacatgcgtatttaccggaacctggactatggccgcctggcacgc
tttcatgtgctggacggtcggcagtatcgttccgaacaggcgtgcatccaggccaacggt
agccgtcgaggctacgtagcgcccagcgattgcacggatctgagtgacccgaaacgcacc
atgctgggctgggaacaggaagcctggctggaccgcagcttcgctgagtcacctggacaa
tggaatgtcattgcccaggacttgctggtcgctccgctggaacagcgcaatctcaaaacg
caggcgctgggccactggaccgatggctgggacggctacgcggcgacccgcgagcgcatg
ctggcatccctgcaacgccaccagacccgcaacccggtgttctgggggggcgacatccat
tcgttctggaccaccgacctgcacgccgatgcgggcaatccggattcagccgtcgtcgcc
actgaattcgtcggcacctcggtgacatccggcggaccgccattcgaggccttcaacagc
attctcggtctaaacccccacgtgaagttttttgacagccgccagcgtggctatgtggcg
gtggacctcagcgagcaacagatgctgacccgctttcaggtggtgtcggatgtgctcgac
cccgctgccagcgtgtcaacgctcaagcgttttgcggtggaggctggcaaagccggggcc
gttcctgtgtag

DBGET integrated database retrieval system