KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1029Help
Entry
PSPTO_1029        CDS       T00118                                 

Gene name
wssD
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPTO_1029 (wssD)
Enzymes [BR:pst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PSPTO_1029 (wssD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1125622..1126833
Genome map
AA seq 403 aa AA seqDB search
MPTLVINLRRAVGWMTGVLASATLTPALAASTCDGPAWPFWQDYATRYVQADGRMLESSL
KANHSTSEGQSYGMLFALVANDRARFDTLWTWTAENMTGADPRTRLPGWLWGQGEDGSWK
LQDANSASDADLWIIYALLEAARIWQHPAYRNDALALLKTVEARLVVNLPGLGKMLLPGP
EGFVQPDHLWRLNSSYLPVPLLRRLAREEPAGPWKEIADNTAKLIDASSPKGFIADWVGY
RGTSPKTGLFVVDPVSGELGSYDAIRVYLWAGMTPASDPLAARLLARLDGMAVSTASSGT
PPEKVQVMSGASQGQAPFGYSAALLPYFQAKGQTWLAEQQQRRVEAGVSTALARDPTDRT
EPAYYNLMLSLFALGWVEKRYQFREDGTLKLSWETSCPRAATR
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccctggtaatcaatttgcgccgcgctgttggctggatgaccggtgtgctggcg
tcggcgacgctgaccccggctcttgcggccagcacctgcgacggcccggcctggccgttc
tggcaggactacgccacgcgctacgtgcaggccgacgggcgcatgctcgaatccagcctg
aaagccaaccacagcacctccgaaggccagtcctacggcatgctcttcgccttggtggcc
aatgatcgcgcgcgcttcgacacgctgtggacgtggactgccgaaaatatgaccggcgcc
gaccccaggacacgcctgcccggctggttgtgggggcagggcgaagatggcagctggaaa
ctgcaggacgccaactctgcgtccgacgccgacctgtggatcatctatgcgctgctggaa
gccgcccgcatctggcagcacccggcgtatcgaaacgatgcgctggcactgctcaagacc
gttgaagcgcggctggtggtcaacctgccggggctgggcaagatgctcctgcccggcccg
gaaggtttcgtgcagcccgaccacttatggcgtttgaactccagttacctgccggtgccg
ctgttacggcgtctggccagggaagagccggccgggccatggaaggaaatcgccgacaac
acggcaaaactgatcgacgcatccagcccgaaaggctttatcgccgactgggtgggttat
cgcggcacatcaccgaaaaccgggctgttcgtggtcgatccggtctccggcgagctgggc
agctatgacgcgattcgcgtctacctctgggcgggcatgacgcctgcgtccgacccgttg
gccgcacgcttgctggcgcgtctcgacggcatggcggtcagcacggcctccagcggtacg
cccccggaaaaagtccaggtgatgagtggcgcgagccagggccaggcgccgtttggttat
tcggcggcgttgctgccgtacttccaggccaagggccagacgtggctggcggaacagcag
cagcgcagggtcgaagccggtgtcagcacggcgctggcccgcgacccgacagaccgtacc
gaacctgcctattacaacctcatgctcagcctgtttgccttgggctgggtcgaaaaacgc
tatcagttccgtgaagacgggaccctcaagttgtcatgggagacgtcatgcccgcgcgcc
gccacacgttag

DBGET integrated database retrieval system