KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1077Help
Entry
PSPTO_1077        CDS       T00118                                 

Gene name
rfbC-1
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:pst00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:pst00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(1181491..1182036)
Genome map
AA seq 181 aa AA seqDB search
MNATRLAIPDVIVFEPKTFGDDRGFFFESFNQKAFEEVVGRSVKFVQDNHSRSVKGVLRG
LHYQIQQPQGKLVRVTVGEVFDVAVDLRKSSPTFGKWVGLHLTAENKKQLWIPEGFAHGF
IVLSESAEFLYKTTDYWAPEHERSLAWNDATVGIEWPFSETPSLSAKDQKAVAFEDAEVF
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcaacacgcctcgccattccagacgtcatcgtattcgagcccaaaaccttcgga
gacgatcgtggctttttctttgaaagcttcaaccagaaggcgttcgaggaggtcgttggc
cggtcggtgaaatttgttcaggacaaccactctcgctcggtgaaaggggtgctgcgcggc
ttgcattaccaaattcaacaaccacagggcaagcttgtccgggtgactgtgggcgaggtg
ttcgacgtcgcagtcgacttgcgtaaaagctcaccgaccttcggcaagtgggtgggtctg
catctcaccgccgaaaacaagaaacagctctggataccggaaggctttgctcacgggttc
atcgttttgtccgaaagcgcagagtttctctacaagacgacagactactgggcgccggaa
cacgagcgcagccttgcctggaatgacgccaccgtaggcattgaatggccgttcagcgaa
acgccgtccctgtccgccaaagaccaaaaggccgtcgcattcgaagacgcagaggtgttc
gcttaa

DBGET integrated database retrieval system