KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1183Help
Entry
PSPTO_1183        CDS       T00118                                 

Definition
(RefSeq) dihydromonapterin reductase
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00670  One carbon pool by folate
pst00790  Folate biosynthesis
pst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PSPTO_1183
   00670 One carbon pool by folate
    PSPTO_1183
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     PSPTO_1183
    1.5.1.50  dihydromonapterin reductase
     PSPTO_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR NmrA Epimerase NAD_binding_10 TrkA_N
Motif
Other DBs
NCBI-GeneID: 1182819
NCBI-ProteinID: NP_791015
UniProt: Q887V0
Position
complement(1295825..1296535)
Genome map
AA seq 236 aa AA seqDB search
MALSSAPILITGASQRVGLHCALRLLEHGHQVIISYRTEHASVAQLRQAGAHTLHGDFSS
EASIMAFIEQLKSHTSSLRAIVHNASEWLAETPGDEAENFTRMFSVHMLAPYLINLHCEA
LLHASDVADIVHISDDVTRKGSSKHIAYCATKAGLESLTLSFAARFAPLVKVNGIAPALL
MFQPKDDAAYRANALAKSAMGIEPGAEVIYQSLRYLLDSTYVTGTTLTVNGGRHVK
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggcattatcttctgcaccgatcctgattaccggcgccagccagcgcgtgggcctgcat
tgcgcgctgcgcctgcttgaacacgggcatcaggtcatcatcagttaccgaaccgaacac
gccagtgtggcccaactgcgccaggccggtgcgcataccctgcacggcgatttttcgagc
gaagcctcgatcatggcgttcatcgagcagttgaaatcccacacctcaagcctgcgtgcc
attgtgcacaacgcgtccgagtggctggctgaaacgccaggcgacgaagccgaaaacttc
acgcgcatgttcagcgtgcacatgctcgccccgtacctcatcaacctgcattgcgaggca
ctgttacacgccagcgacgtcgccgacatcgtgcacatcagcgatgacgtgacccgcaag
ggcagcagcaagcacattgcctattgcgcaaccaaggccgggctggaaagcctcaccctg
tcgttcgccgcaaggttcgccccgcttgtcaaagtcaacggcatagcaccggcgctgttg
atgtttcaacccaaggacgatgcggcctaccgcgccaacgccctggccaagtcggctatg
ggcatagagcctggtgcagaagtgatctaccagagcctgcgctaccttctggacagcacc
tatgtcaccggcacaacactgaccgtaaacggcggacggcacgtcaagtaa

DBGET integrated database retrieval system