KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1289Help
Entry
PSPTO_1289        CDS       T00118                                 

Gene name
glk
Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPTO_1289 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_1289 (glk)
   00052 Galactose metabolism
    PSPTO_1289 (glk)
   00500 Starch and sucrose metabolism
    PSPTO_1289 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPTO_1289 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPTO_1289 (glk)
   00524 Butirosin and neomycin biosynthesis
    PSPTO_1289 (glk)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     PSPTO_1289 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1418302..1419267
Genome map
AA seq 321 aa AA seqDB search
MKLALVGDIGGTNARFAIWEDDTLHSVRVFPTIDYAGPEKAIEVYLQDLELQRGDIGYVC
LAVAGPVDGDLFQFTNSHWQLSREAFCADLKVDHLLLINDFTAMALGMTRLKDDEYLTVC
HGVGKPDRPRVVVGPGTGLGIGTLIKLEDSRWMALPGEGGHADLPIGTAREALLWTRLMA
EHEHVSAEVVLSGAGLLLLYQVSCALDGMDAELKSPAAITSAALAGDPVAAAVLEQFCVF
LGRVVGNNVLTLGSLGGVYIVGGVVPRFTEFFMNSGFKRAMGEKGVMSGYFKNLPVWLVT
AEYPGLMGSGVALQQAFGSQI
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttggccctggtcggtgatataggcggtaccaatgcacgttttgccatttgggaa
gacgacacgctgcattctgtccgggtgttcccgaccattgactacgcaggccccgaaaag
gccatcgaagtctatctgcaggaccttgaattgcagcgcggtgacattggctatgtgtgc
ctggcggtcgccgggccggtcgatggcgatctgtttcagttcaccaacagccactggcaa
ctgagccgtgaggcgttctgcgccgacctgaaagtcgatcacctgctgctgatcaacgac
ttcaccgccatggcgctgggcatgacccggctcaaggacgatgaatacctgacggtctgt
catggcgtcggcaagccggatcgcccgcgcgtggtggtcgggccgggcactgggctgggc
atcggcacgctgatcaaactggaagacagccgctggatggccttgccgggcgagggcggg
catgccgacctgccaatcggcacggcgcgcgaggccctgctgtggacgcggctgatggcc
gagcacgaacatgtcagcgccgaagtggtgctcagtggtgcgggcctgttgttgctgtat
caggtcagttgcgcgctggacggcatggacgcagagctcaagtcgcctgctgcgatcacg
tcggctgcgctggcaggcgatccggtcgcggcggcggtgcttgaacagttctgcgtgttc
ctcggcagagtggtcggcaacaacgttctgaccctgggcagtctgggcggggtctacatc
gtgggtggcgtggtgccacgtttcacagaattcttcatgaacagcggcttcaagcgcgcc
atgggcgagaagggcgtgatgagcggctacttcaagaacctgccggtctggctggtcacc
gccgagtacccagggcttatgggttcaggcgttgcgctgcaacaggcgttcggttcgcaa
atttga

DBGET integrated database retrieval system