KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1479Help
Entry
PSPTO_1479        CDS       T00118                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1623892..1624632
Genome map
AA seq 246 aa AA seqDB search
MRLHQIFAAAAVMLASTFSMFAVADAAPDQAIRKTLDSLQLELPVESISPSPLNGLYEVK
LKGGRVLYASADGQFVVQGYLFQVQNGKPVNLTEKTERLAISKTINAIPLSDMVVYPAVG
ETKSHITVFTDTTCPYCHKLHEEVGQLNKMGVEVRYMAFPRQGLGSPGDEQLQAVWCSKD
RKSAMDRMVDGKDIKAAKCDNPVSKQYEIGQSIGVNGTPAIVLADGQVIPGYQPAAQVAK
LAMGAK
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttgcatcagattttcgctgccgccgctgtcatgctggccagcacattcagtatg
tttgccgttgcagatgctgcccccgatcaggccattcgcaagacactggattcgctccag
ctggagctgccggtcgagagcatttcgccgagcccgctcaatggcctttacgaggtcaaa
ctcaagggcggtcgcgtgctgtacgccagcgccgacggtcagttcgtggtgcagggttat
ctgtttcaggtgcagaacggcaagccggtcaacctgaccgaaaagaccgagcgtctggcc
atttccaagaccatcaatgccattccgctttccgacatggtcgtctacccggcggtgggc
gagaccaaatcgcacattacggtgttcaccgacaccacctgcccgtactgccacaagctg
catgaagaagtcgggcagttgaacaaaatgggcgttgaagtccgttacatggccttcccg
cgccagggtctgggttctccgggtgacgaacagttgcaggccgtctggtgttccaaggac
cgtaaaagcgccatggatcgcatggtcgatggcaaggacatcaaagctgccaagtgcgac
aatccggtgagcaagcagtatgaaatcggtcagtcgatcggcgtcaacggcacccctgcg
attgtcctcgccgacggtcaggtgattccgggttatcagcctgctgctcaggttgccaaa
ctggcaatgggcgccaagtaa

DBGET integrated database retrieval system