KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1481Help
Entry
PSPTO_1481        CDS       T00118                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PSPTO_1481 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PSPTO_1481 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PSPTO_1481 (thrC)
Enzymes [BR:pst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PSPTO_1481 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1626188..1627597
Genome map
AA seq 469 aa AA seqDB search
MRYISTRGQAPALNFEDVLLTGLASDGGLYVPENLPRFTQEEIASWAGLPYHELAFKVMR
PFVAGSIPDADFKKILEETYGVFAHSSVAPLRQLNGNEWVLELFHGPTLAFKDFALQLLG
RLLDYVLAKRGERVVIIGATSGDTGSAAIEGCRRCDNVDIFILHPNNRVSDVQRRQMTTI
FGDNIHNIAVEGNFDDCQEMVKDSFADQSFLKGTRLVAVNSINWARIMAQIVYYFHASLQ
LGGPARSVSFSVPTGNFGDIFAGYLARNMGLPVNQLIVATNRNDILHRFMSGNQYVKETL
HATLSPSMDIMVSSNFERLLFDMHGRNGSAIADLMSNFRQGGGFSVEEERWTETRKLFDS
LAVSDEDTCKTIAEVFASTGELLDPHTAIGVKAARECRRSLDTPMVILGTAHPVKFAESV
EKAGVGKALELPAHLSDLFERDERCTVLPNDLKAIQAFVSQHGNRGKPL
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgcgctatatcagtactcgcgggcaagcgcctgcattgaatttcgaagacgtgctgttg
actggtctggccagcgatggtggtctgtatgtgccggaaaacctgccacgtttcacacag
gaagagatcgcttcctgggccggcctgccgtatcacgagctggccttcaaggtgatgcgc
ccgttcgtcgccggaagcattccggacgccgatttcaagaagatcctggaagaaacctat
ggtgtcttcgcccacagctcggtcgcgccgttgcgccagttgaacggcaacgagtgggtg
cttgagctgttccacggcccgaccctggcgttcaaggactttgccctgcaattgctcggt
cgtttgctggactacgtgctggccaagcgcggcgagcgtgtggtgatcatcggtgccact
tcgggcgataccggttctgcggccatcgaaggctgccgtcgctgcgataacgtcgatatc
ttcatcctgcacccgaacaaccgtgtatcggatgttcagcgtcggcagatgaccaccatc
tttggcgataacattcataacatcgcagtggaaggcaacttcgacgactgccaggaaatg
gtcaaggacagcttcgccgatcagagcttcctcaagggcacgcgtctggtggcggtcaac
tcgatcaactgggcgcggatcatggcccagatcgtctactacttccatgcatcgctgcag
ttgggcggcccggcgcgttcggtatcgttctcggtgccgaccggcaacttcggcgacatc
ttcgccggttacctggcgcgcaacatggggctgccggtcaatcaactgatcgttgccacc
aaccgcaatgacattctgcaccgcttcatgagcggcaatcagtacgtcaaggaaaccctg
cacgcaacgttgtcgccgtcgatggacatcatggtctcgtcgaatttcgagcgcctgctg
ttcgacatgcacggtcgcaacggctcggcgattgccgatctgatgagcaatttcaggcag
ggcggcggtttcagtgtcgaagaagagcgctggaccgaaacccgcaaactgttcgactcg
ctggcggtcagcgacgaagacacctgcaagaccatcgccgaggtgttcgccagcaccggc
gagctgctcgacccgcacactgctatcggtgtgaaggctgcccgcgaatgccgtcgcagc
cttgacaccccgatggtgattctggggacggcacatccggtcaagttcgctgagtcagtg
gagaaggccggtgtaggaaaagcgctggagctacctgcacatttgtctgatttgttcgag
cgtgacgaacgttgcaccgtgttgccaaatgacctgaaagccatacaggcgtttgtcagc
cagcatggcaatcgcggcaaaccgctctga

DBGET integrated database retrieval system