KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1498Help
Entry
PSPTO_1498        CDS       T00118                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:pst00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPTO_1498
Enzymes [BR:pst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     PSPTO_1498
Two-component system [BR:pst02022]
 CheA family
  WspE-WspRF [MD:M00509]
   PSPTO_1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1654863..1655873
Genome map
AA seq 336 aa AA seqDB search
MKIAIVNDMPMAIEALRRALAFEPAHQVIWVAANGADAVQRSIEQTPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDREQNMRRVFEAMGHGALDVVDTPAIGGPNPREAAAPLL
RKILNIDWLMGQRVGRERVVTTSRSEVSRRDRLVAIGSSAGGPAALEILLKGLPENFPAA
IVLVQHVDQVFAAGMAEWLCSASGMPVRLAKEGETPQVGVVLLAGTNHHIRLLKDGTLAY
TAEPVNEVYRPSIDVFFESVTRYWTGEAVGVLLTGMGRDGAQGLKAMRERGFLTIAQDQA
SSAVYGMPKAAAAIDAAVEIRPLHTIAPRLMEVFTQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgccattgtcaacgacatgcctatggccatcgaggcgttacgtcgtgcgctg
gctttcgagcctgcacaccaggtcatctgggtggcggccaatggtgccgacgctgtgcag
cgcagcatcgagcagacgccggatctgatcctgatggacttgatcatgcccgtgatggac
ggtgtagaggcgacacggcgcatcatggccgagacgccatgcgctattgtcattgtgacc
gtcgaccgcgagcagaacatgcgccgcgtgttcgaagccatggggcacggcgcgctggat
gtggtagacacgccggccatcggcggccccaaccccagagaagccgcagcgccgttgctg
cgcaagatacttaatatcgattggctcatgggccagcgtgtcggccgtgagcgcgtggtg
accacgtccaggtcagaggtctcaagacgcgacaggctggtcgccattggttcatcggcg
ggtggcccggcggcgctggagatcctgctcaaggggcttccggaaaatttcccggcagcc
attgtgctggtgcagcatgtggatcaggtgtttgctgcaggcatggccgagtggctgtgc
tcagcgtcgggcatgccggtacgcttggcaaaagagggcgaaacgccgcaagtcggtgtt
gtactgctggccgggaccaaccatcatattcgcttgttgaaggacggcacgctggcgtac
accgcagagccggtcaacgaagtttacaggccctcaatcgatgtgtttttcgagagcgtg
actcgttattggactggtgaggctgtgggcgttttattgactggcatggggcgcgatggc
gcgcaggggctcaaggccatgcgtgagcggggctttctgaccatcgctcaggatcaggcc
agttctgcggtgtatggcatgcccaaggctgccgccgccattgatgcggccgtcgaaatc
cgcccgctgcacacgattgcgccgcgcttgatggaggtatttactcaatga

DBGET integrated database retrieval system