KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1498Help
Entry
PSPTO_1498        CDS       T00118                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K13491  
two-component system, chemotaxis family, response regulator WspF [EC:3.1.1.61]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Two-component system
Module
WspE-WspRF (chemosensory) two-component regulatory system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:pst02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1654863..1655873
Genome map
AA seq 336 aa AA seqDB search
MKIAIVNDMPMAIEALRRALAFEPAHQVIWVAANGADAVQRSIEQTPDLILMDLIMPVMD
GVEATRRIMAETPCAIVIVTVDREQNMRRVFEAMGHGALDVVDTPAIGGPNPREAAAPLL
RKILNIDWLMGQRVGRERVVTTSRSEVSRRDRLVAIGSSAGGPAALEILLKGLPENFPAA
IVLVQHVDQVFAAGMAEWLCSASGMPVRLAKEGETPQVGVVLLAGTNHHIRLLKDGTLAY
TAEPVNEVYRPSIDVFFESVTRYWTGEAVGVLLTGMGRDGAQGLKAMRERGFLTIAQDQA
SSAVYGMPKAAAAIDAAVEIRPLHTIAPRLMEVFTQ
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgccattgtcaacgacatgcctatggccatcgaggcgttacgtcgtgcgctg
gctttcgagcctgcacaccaggtcatctgggtggcggccaatggtgccgacgctgtgcag
cgcagcatcgagcagacgccggatctgatcctgatggacttgatcatgcccgtgatggac
ggtgtagaggcgacacggcgcatcatggccgagacgccatgcgctattgtcattgtgacc
gtcgaccgcgagcagaacatgcgccgcgtgttcgaagccatggggcacggcgcgctggat
gtggtagacacgccggccatcggcggccccaaccccagagaagccgcagcgccgttgctg
cgcaagatacttaatatcgattggctcatgggccagcgtgtcggccgtgagcgcgtggtg
accacgtccaggtcagaggtctcaagacgcgacaggctggtcgccattggttcatcggcg
ggtggcccggcggcgctggagatcctgctcaaggggcttccggaaaatttcccggcagcc
attgtgctggtgcagcatgtggatcaggtgtttgctgcaggcatggccgagtggctgtgc
tcagcgtcgggcatgccggtacgcttggcaaaagagggcgaaacgccgcaagtcggtgtt
gtactgctggccgggaccaaccatcatattcgcttgttgaaggacggcacgctggcgtac
accgcagagccggtcaacgaagtttacaggccctcaatcgatgtgtttttcgagagcgtg
actcgttattggactggtgaggctgtgggcgttttattgactggcatggggcgcgatggc
gcgcaggggctcaaggccatgcgtgagcggggctttctgaccatcgctcaggatcaggcc
agttctgcggtgtatggcatgcccaaggctgccgccgccattgatgcggccgtcgaaatc
cgcccgctgcacacgattgcgccgcgcttgatggaggtatttactcaatga

DBGET integrated database retrieval system