KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1561Help
Entry
PSPTO_1561        CDS       T00118                                 

Definition
hypothetical protein
Orthology
K06176  
tRNA pseudouridine13 synthase [EC:5.4.99.27]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
1723431..1724489
Genome map
AA seq 352 aa AA seqDB search
MNELELLGPRAYGDALGRAALKATAEDFQVDEVLDIPLSGDGEHLWLWVEKRGLNTVEAA
RRLARAAGVQLRTVSYAGLKDRQALTRQWFSIQLPGKADPDLSAAQDATLQILKSGRHKR
KLQRGAHAANGFTLRLTQLEGDKEALNQRLETIALQGIPNYFGVQRFGYQGGNLGEARDY
AGRKALPEQRAVRSRLLSTARSYLFNRVLAARVADGSWQKAQVGDLLAFTDSRSFFPADV
DECSDPRLAILDLHPTGPQWGEGPSPAGGATAALENAIANDESVLRDWLVRAGMEHERRI
LRLPIGRLTWHYPEPDILQLEFVLPPGCFATVLVRELVDLVPVGQTDSPCVF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaactcgaactgctggggccgcgggcttacggcgatgcactggggcgtgcagcc
ctgaaggctacagccgaagactttcaggttgacgaagtactcgacatcccgctgtccggc
gatggcgagcacttgtggctgtgggtcgaaaagcgcggcctgaacaccgtggaagcggct
cgcaggctggcacgtgccgcaggtgttcagttgcgcacggtcagttacgccggattgaaa
gaccgccaggcgctgacccgccaatggttcagcattcagctgccgggcaaggccgatccg
gacctttcggccgcgcaggacgctacgctgcagattctcaagagcgggcgacacaagcgc
aaattgcagcgcggtgcccacgccgccaatggtttcacgctcaggctgacccaactggag
ggtgacaaggaggcgttgaatcaacgccttgaaaccatcgccctgcagggcatacccaac
tatttcggtgtgcagcgtttcggctatcagggcggcaatctgggcgaggcgcgcgattac
gcaggccgtaaggcgctgcctgaacaacgtgcagtgcgttcgcggctgttgtccaccgcg
cgcagctaccttttcaatcgtgtcttggcagcgcgtgttgccgatggcagctggcagaag
gctcaggtaggcgatttgctggcgttcactgacagccgcagctttttcccggctgatgtt
gatgaatgcagcgacccccgactggcaattctcgacctccatcccaccggcccgcagtgg
ggtgaaggcccatcgccagctggcggtgccaccgcagcgctggaaaacgccatcgccaac
gacgagtccgtgctgcgcgactggctggtcagggccggtatggagcacgaacgtcgcatc
ctgcgactgcccattgggcggctgacgtggcattatcccgagcctgacattctgcaactg
gaattcgtccttccgcccggatgctttgccactgttttggtgcgcgaactcgttgatctg
gtgccggttgggcagacggacagcccatgcgtattctga

DBGET integrated database retrieval system