KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1781Help
Entry
PSPTO_1781        CDS       T00118                                 

Definition
(RefSeq) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00480  Glutathione metabolism
pst00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    PSPTO_1781
  Metabolism of other amino acids
   00480 Glutathione metabolism
    PSPTO_1781
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     PSPTO_1781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 1183418
NCBI-ProteinID: NP_791606
UniProt: Q885Q0
Position
1950687..1951172
Genome map
AA seq 161 aa AA seqDB search
MSENLLNIPVTTIKGEQKTLADFAGKAVLVVNTASKCGFTPQYKGLEKLWQDYKDQGLVV
LGFPCNQFGKQEPGDEGAISGFCELNYGVSFPLFKKVDVNGDQAHPLFVQLKEQAPGLLG
TERIKWNFTKFLIGQDGKLVKRFAPLTKPEELTDEIEALLR
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaaacctgctgaacatcccggtcacgacgatcaagggagaacagaaaaccctc
gccgatttcgctggcaaggcggtcctggtggtcaatacggccagcaaatgcggtttcacg
ccccaatacaaagggctggaaaaactctggcaggactacaaggatcaggggttggtggtg
ctcggctttccgtgcaaccagttcggcaagcaggagccgggagacgagggcgctatttcc
ggtttttgcgaactgaactacggcgtcagcttcccgctgttcaagaaagtcgatgtcaac
ggtgatcaggcccatcccttgttcgttcagctcaaggagcaggcgccggggctgctgggc
accgagcgcatcaagtggaatttcaccaagttcctgattggtcaggacggcaagctggtc
aagcgttttgcgccattgaccaagcctgaagaactgacggatgaaattgaagcgctgctg
cgttaa

DBGET integrated database retrieval system