KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_1923Help
Entry
PSPTO_1923        CDS       T00118                                 

Definition
(RefSeq) hypothetical protein
Organism
pst  Pseudomonas syringae pv. tomato DC3000
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(2106563..2107309)
Genome map
AA seq 248 aa AA seqDB search
MNGSSADDAPQPPKVLNTPLEIAANLRLLLESHDPLIITFHERAQRFQSYLLEVDRDSNV
MALDEMIPRDGERFLSNGESFRVEGFHDGVRIAWESSAHMDIVDTDGQRMYRGPMPEEVI
YHQRRNAFRAALKLAQLVDIEIGGDRLKSPLKGKLLDISATGCKLRFEGDLSERMQLGQV
YERFIAKLPFGAMTAPVELRYLHFEERVHTTFAGVRFHNMSGLVQRQVERFVYQLQREAR
RFDKDDDF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
gtgaatggctcaagcgcggacgatgctccgcagcccccgaaggtcctcaacacacctttg
gaaattgccgccaacctgcggctgttactcgagagtcatgatccgctgatcattaccttc
catgagcgcgcccagcgctttcaaagctacctgcttgaagtcgaccgtgacagcaatgtc
atggcgctcgacgaaatgatcccccgtgacggcgaacgttttctcagcaacggcgagtct
tttcgtgtcgaaggttttcacgatggcgtgcgtatcgcctgggaaagctcggcgcacatg
gacatcgtcgataccgacgggcagcgcatgtaccgcgggccgatgcctgaggaagtcatt
taccaccagcgtcgcaacgcattccgtgcagcgttgaagctggcgcaactggtcgatatc
gagatcggcggtgaccgtctcaagtctccgctcaaaggcaagctgctggacatctccgcc
accggatgcaaactccgttttgaaggcgacctgtccgagcgcatgcaattgggccaggtg
tacgagcggttcattgccaagctgccgttcggtgccatgacagcccccgtcgagctgcgc
tatctgcactttgaagagcgcgttcacaccacgtttgccggggtgcgcttccacaacatg
agtggactggtgcagcgccaggtcgagcgctttgtctatcagttgcagcgtgaagcgcgc
cgcttcgataaagacgacgacttctga

DBGET integrated database retrieval system