KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2070Help
Entry
PSPTO_2070        CDS       T00118                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    PSPTO_2070
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPTO_2070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(2248078..2248446)
Genome map
AA seq 122 aa AA seqDB search
MKRTALLVLALVLHPMAQGAGDAEAGKAVFTRLCSGCHKIGPSARSAFGPPLNGIIGRKA
GQQEGYVYTDAMKNSGLIWTREELRMYIKDPSEVVPGTRMKLWWMGNDERMEDLLEYLDA
NK
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagaactgcgttattggtactggcactggtgctgcatccgatggcccaaggtgca
ggcgatgcagaggccgggaaggcagtgttcacccgcctctgctcaggttgccacaagatc
ggcccttctgcgcgcagcgcatttggcccaccgcttaacggcatcattggtcggaaggca
ggtcagcaggaaggttacgtgtacaccgatgcgatgaaaaactcggggctgatctggacg
cgcgaagaattgcgcatgtacatcaaggacccaagcgaagttgtgcccggtacacgcatg
aaactgtggtggatgggcaacgatgaaagaatggaggacctgctcgaatacctggatgcc
aacaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system