KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2196Help
Entry
PSPTO_2196        CDS       T00118                                 

Definition
(RefSeq) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00020  Citrate cycle (TCA cycle)
pst00190  Oxidative phosphorylation
pst00650  Butanoate metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01200  Carbon metabolism
Module
pst_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pst_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pst_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPTO_2196
   00650 Butanoate metabolism
    PSPTO_2196
  Energy metabolism
   00190 Oxidative phosphorylation
    PSPTO_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-GeneID: 1183847
NCBI-ProteinID: NP_792017
UniProt: Q884A0
Position
2416353..2416721
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIF
SLLALVALGAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcaccaacctttcgcgttcgggcctctatgactggatggcccagcgt
gtatctgcggtcgtgctcgcggcttatttcatattcctgatcgggtacatggtctttcat
ccgggtctgagctacgcccaatggcatgatctgttcgcacataacgggatgcgtatcttc
agtctgctggccctcgttgcccttggcgctcacgcctgggtcggcatgtggaccatcgcg
accgactacctgacgccgatggcgctgggcaagtccgccactgcggtacgttttctgttt
caggcggtatgcggcgttctgatgttcgcctacttcgtctggggcgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system