KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2196Help
Entry
PSPTO_2196        CDS       T00118                                 

Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPTO_2196
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPTO_2196
   00650 Butanoate metabolism
    PSPTO_2196
  Energy metabolism
   00190 Oxidative phosphorylation
    PSPTO_2196
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2416353..2416721
Genome map
AA seq 122 aa AA seqDB search
MVTNVTNLSRSGLYDWMAQRVSAVVLAAYFIFLIGYMVFHPGLSYAQWHDLFAHNGMRIF
SLLALVALGAHAWVGMWTIATDYLTPMALGKSATAVRFLFQAVCGVLMFAYFVWGVQILW
GI
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaacgtcaccaacctttcgcgttcgggcctctatgactggatggcccagcgt
gtatctgcggtcgtgctcgcggcttatttcatattcctgatcgggtacatggtctttcat
ccgggtctgagctacgcccaatggcatgatctgttcgcacataacgggatgcgtatcttc
agtctgctggccctcgttgcccttggcgctcacgcctgggtcggcatgtggaccatcgcg
accgactacctgacgccgatggcgctgggcaagtccgccactgcggtacgttttctgttt
caggcggtatgcggcgttctgatgttcgcctacttcgtctggggcgtgcagattctttgg
ggtatctga

DBGET integrated database retrieval system