KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2200Help
Entry
PSPTO_2200        CDS       T00118                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPTO_2200 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSPTO_2200 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    PSPTO_2200 (sucB)
Enzymes [BR:pst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PSPTO_2200 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2422347..2423567
Genome map
AA seq 406 aa AA seqDB search
MAIDIKAPSFPESVADGTISKWYKKEGDAVKRDEMLVDIETDKVVLEVLAEADGVMGAIT
KEEGAIVLSNEVLGTLNDGATASAAPAPAAAPASAPAAAPAAAGEEDPIAAPAARQLAEE
NGINLASVKGTGKDGRITKEDIVAAVEAKKSAPAAAPAAKPVAAAAPVVAAGDRTEKRVP
MTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGSDIVYHGYADVGVAVSSDRGLVVPVLRNAEHMSLAEIEGGI
ATFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAVN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgatatcaaagccccctctttcccggaatccgttgccgatggcaccatttcc
aagtggtacaaaaaagagggtgatgcggtaaagcgcgacgagatgctggttgacatcgag
actgacaaggttgtcctggaagtactggccgaagctgatggcgtgatgggcgcgatcacc
aaggaagagggcgctatcgtcctgtccaatgaagtgcttggcacgttgaatgacggtgcc
acggcatctgctgctccagcacccgctgctgcgcctgcttcggcacctgccgctgcaccg
gctgccgctggcgaagaagacccgattgccgcgcctgctgcgcgtcaactggctgaagag
aacggcatcaacctggccagcgtcaagggcaccggtaaagacggccgtatcaccaaggaa
gacatcgttgctgccgttgaagcgaagaaatccgctccagccgctgcgcctgctgccaag
cctgtcgccgctgctgctccggtcgttgccgctggcgaccgcaccgagaagcgcgtgccg
atgacccgcgttcgtgcaaccgttgccaagcgtctggtcgaagcccagtcgaacatggcg
atgctgaccacgttcaacgaagtcgacatgaccgaagtcatggcgctgcgttcgaagtac
aaggacctgttcgagaagtcgcacaatggcgtacgtctgggcttcatgtccttcttcgta
aaagcggccaccgaagcgctgaaacgcttcccggcagtcaacgcttcgatcgacggttct
gacatcgtttaccatggttatgccgacgtcggtgtagcggtttccagcgatcgcggcctg
gttgtgccggttctgcgtaacgccgagcacatgagcctggctgaaatcgaaggcggcatc
gccaccttcggcaaaaaagcccgtgacggtaagctgtccatcgatgagatgaccggtggc
accttcacgatcaccaacggtggtactttcggttcgatgatgtcgacgccgatcgtcaac
ccgccacaggctgcaattttgggaatgcacaacattctgcaacgcccgatggcagtcaac
ggtcaggttgtgattcgcccgatgatgtatctggcgctgtcttacgatcaccgtttgatc
gatggtaaagaagcagtaactttcctcgttaccatcaagaacctgctggaagatccagct
cgtctgttgctggatatctga

DBGET integrated database retrieval system