KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2200Help
Entry
PSPTO_2200        CDS       T00118                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pst01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:pst00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:pst00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2422347..2423567
Genome map
AA seq 406 aa AA seqDB search
MAIDIKAPSFPESVADGTISKWYKKEGDAVKRDEMLVDIETDKVVLEVLAEADGVMGAIT
KEEGAIVLSNEVLGTLNDGATASAAPAPAAAPASAPAAAPAAAGEEDPIAAPAARQLAEE
NGINLASVKGTGKDGRITKEDIVAAVEAKKSAPAAAPAAKPVAAAAPVVAAGDRTEKRVP
MTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGFMSFFV
KAATEALKRFPAVNASIDGSDIVYHGYADVGVAVSSDRGLVVPVLRNAEHMSLAEIEGGI
ATFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQRPMAVN
GQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgatatcaaagccccctctttcccggaatccgttgccgatggcaccatttcc
aagtggtacaaaaaagagggtgatgcggtaaagcgcgacgagatgctggttgacatcgag
actgacaaggttgtcctggaagtactggccgaagctgatggcgtgatgggcgcgatcacc
aaggaagagggcgctatcgtcctgtccaatgaagtgcttggcacgttgaatgacggtgcc
acggcatctgctgctccagcacccgctgctgcgcctgcttcggcacctgccgctgcaccg
gctgccgctggcgaagaagacccgattgccgcgcctgctgcgcgtcaactggctgaagag
aacggcatcaacctggccagcgtcaagggcaccggtaaagacggccgtatcaccaaggaa
gacatcgttgctgccgttgaagcgaagaaatccgctccagccgctgcgcctgctgccaag
cctgtcgccgctgctgctccggtcgttgccgctggcgaccgcaccgagaagcgcgtgccg
atgacccgcgttcgtgcaaccgttgccaagcgtctggtcgaagcccagtcgaacatggcg
atgctgaccacgttcaacgaagtcgacatgaccgaagtcatggcgctgcgttcgaagtac
aaggacctgttcgagaagtcgcacaatggcgtacgtctgggcttcatgtccttcttcgta
aaagcggccaccgaagcgctgaaacgcttcccggcagtcaacgcttcgatcgacggttct
gacatcgtttaccatggttatgccgacgtcggtgtagcggtttccagcgatcgcggcctg
gttgtgccggttctgcgtaacgccgagcacatgagcctggctgaaatcgaaggcggcatc
gccaccttcggcaaaaaagcccgtgacggtaagctgtccatcgatgagatgaccggtggc
accttcacgatcaccaacggtggtactttcggttcgatgatgtcgacgccgatcgtcaac
ccgccacaggctgcaattttgggaatgcacaacattctgcaacgcccgatggcagtcaac
ggtcaggttgtgattcgcccgatgatgtatctggcgctgtcttacgatcaccgtttgatc
gatggtaaagaagcagtaactttcctcgttaccatcaagaacctgctggaagatccagct
cgtctgttgctggatatctga

DBGET integrated database retrieval system