KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2268Help
Entry
PSPTO_2268        CDS       T00118                                 

Definition
acyl-CoA thioesterase I
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    PSPTO_2268
Enzymes [BR:pst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     PSPTO_2268
   3.1.2  Thioester hydrolases
    3.1.2.-  
     PSPTO_2268
Lipid biosynthesis proteins [BR:pst01004]
 Fatty acid synthase
  Component type
   PSPTO_2268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
2512424..2513029
Genome map
AA seq 201 aa AA seqDB search
MRAWFLSAGLGLLLLSQGAMAGTVLIVGDSISAAFGLDTRVGWVSLLEQRLKAEGYTDKV
VNASISGDTSAGGQARLPALLAEHKPALVILELGGNDGLRGQQPAQLQQNLSSMIDSSRA
AGARVLLLGMQIPPNYGPRYTTAFKEVYSHLAEEKKVPFVPFFLEGVGGVPGLMQADGLH
PAAAAQGKLLENVWPSLKPLL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgcgtggtttttaagtgctggcctggggttgttgctgctgtcacagggggcgatg
gcgggcacagtcttgatcgttggggatagtatcagtgcggctttcggcctggatacccgt
gtggggtgggtcagcctgcttgaacagcggctcaaggccgagggatacaccgacaaggtg
gtcaatgcgtcgatcagcggcgacaccagtgccgggggccaggcgcgtctgcctgcgctg
cttgcagagcataagcccgcgctggtcattctcgaattgggtggcaacgacgggttgcgt
ggccagcagccagctcaattgcaacaaaacctttcgtcgatgatcgacagctcacgcgcg
gccggtgccagggtgctattgctcggtatgcagataccgcccaattacggcccgcgttac
accaccgccttcaaagaggtctacagccatctggccgaagagaaaaaggtgccgttcgtg
ccgttctttctcgaaggtgtcggcggggtgcccgggttgatgcaggccgatggtctgcat
cccgccgcagcggcgcagggcaagttgctggaaaatgtctggccgagcctgaaaccgctg
ctttga

DBGET integrated database retrieval system