KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2371Help
Entry
PSPTO_2371        CDS       T00118                                 

Gene name
rbsK
Definition
(RefSeq) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    PSPTO_2371 (rbsK)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     PSPTO_2371 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DNA_processg_A
Motif
Other DBs
NCBI-GeneID: 1184022
NCBI-ProteinID: NP_792187
UniProt: Q883I6
Position
2622858..2623778
Genome map
AA seq 306 aa AA seqDB search
MQAKVVIVGSLNMDLVIRAQRLPRPGETLSGETFDTVPGGKGANQAVAAARLGASVAMIG
CVGADAYGQQLRAALLAECIDCQAVTVVEGVSTGIASIVVDANSQNAIVIVAGGNGRLTP
ALIERFDALLAGSEIVICQLEVPTETVFHTLSRARALGKTVILNPAPASEPLPASWYGLI
DYLIPNESEAQTLTGVNVDSAASAEQAAMAMLAAGARNVIITLGERGTLFANAAGVEHIP
ARRVQAVDTTAAGDTFVGGFAAALAAGQGESQAIRFGQAAAAISVTRAGAQPSIPTFEEV
QELNSL
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaaaagtagtgatagtgggcagtctgaacatggatctggtcatccgcgcccag
cgtttgccacgccccggtgaaacactcagcggggaaaccttcgacaccgtgcccggcggc
aaaggcgccaatcaggcagttgctgcggcgcgcctgggtgccagcgtggcaatgatcggt
tgcgtaggcgccgatgcctatgggcagcaactgcgggcggcgctgctggccgagtgcatc
gactgccaggcggtgaccgtcgtggagggcgtctccaccggcattgcatcgatcgtggtc
gacgccaacagccagaatgccatcgtcattgtggctggcggcaatggtcggctcaccccg
gcgctgatcgagcgtttcgatgcgttgctggcaggctccgagatcgttatctgtcagttg
gaagtcccgactgaaaccgttttccataccctgtccagggcccgtgcgctgggcaagacc
gtcattctcaatccggccccggccagcgagccattgcccgcaagctggtacggcctgatc
gattacctgatccccaacgaaagcgaagcgcagaccctgacgggtgtgaatgtcgattca
gccgcctctgccgaacaggctgccatggcaatgctggcggccggagcgcgcaacgtgatc
atcaccctcggcgagcgcggcactctgttcgccaatgccgctggcgtggagcatattcct
gcgcgtcgtgtacaggccgtggacaccaccgctgcaggtgatacctttgtcggtggtttt
gcggcagcactggccgctggtcagggcgagtcgcaagccattcgcttcggtcaggcggcg
gcggccatatccgtcacccgcgcgggtgcccagccgtccataccgacgttcgaggaagta
caggaactcaattcgttatga

DBGET integrated database retrieval system