KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2636Help
Entry
PSPTO_2636        CDS       T00118                                 

Gene name
galM
Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_2636 (galM)
   00052 Galactose metabolism
    PSPTO_2636 (galM)
Enzymes [BR:pst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     PSPTO_2636 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2929175..2930323)
Genome map
AA seq 382 aa AA seqDB search
MKKHALLSTFGLSLMISTLTAQAAALSSEHSAFGQLPDGSAIEKYTLRNSHGVQASIITY
GATLQSLLVPDKAGKVEDIVLGFDDVQGYQSNGTVYFGATIGRFGNRLAGGKFSLDGKTY
QVPLNDKTNALHGGDKGFDKRLWKAEETRTGDSVGVKLTYVSPDGEMGFPGTLQTEVTYS
LNDKNELKIDYRATTDKPTVLNLTNHSYFNLAGAGSGDVLKQVATLHASHYTPVNDKLIP
TGELPAVAGTPMDFLKPTAFGKHIKDDHQQLKYAEPKQGGFDFNWVLDSKGDVKKLAAEV
SDPQSGRTLQLFTTEPGVQLYTGNFLDGSIHGKGGKVYPHWGAFTLETQHYPDAPNQPKF
PSTRLDPGKAYTQTTVFKFLNN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcatgctcttctcagcacctttggactgtccttgatgatcagtaccttgacc
gcacaggccgcagcactctccagcgaacacagcgcgtttgggcaactgcccgatggcagc
gccatcgagaaatataccctgcgcaacagccatggcgtgcaggccagcatcatcacttat
ggcgcaaccctgcaatcactgctggtgcccgacaaggctggcaaggtggaagacatcgtg
ctgggcttcgacgatgtgcagggctatcagagcaacggcacggtttattttggcgcgacc
atcggccgtttcggcaaccgtctggcgggcggcaaattcagtctggatggcaagacctac
caggttccgctcaacgacaagaccaatgccctgcacggcggcgacaagggtttcgacaag
cgactctggaaggcggaagaaaccaggaccggtgattcggtcggcgtgaaactgacctac
gtgtcgccggatggcgagatgggtttcccgggcacgttgcagactgaagtcacctacagc
ctgaacgacaagaatgaactgaaaatcgactaccgcgccaccaccgacaaacccacggtg
ctgaacctgaccaaccacagctatttcaacctcgcgggcgcaggcagcggcgatgtgctc
aagcaggtcgccacccttcacgcttcgcactacaccccggtcaacgacaagctgatcccg
acgggcgaactgcccgccgtcgccggcacgccgatggacttcctcaagcccaccgcgttt
ggcaaacacatcaaggatgaccaccagcagctgaaatatgccgaacccaaacagggcggc
tttgatttcaactgggtgctggacagcaaaggcgatgtgaagaaactcgccgccgaggtc
agcgacccgcaatcgggccgcacgctgcaattgttcactaccgagcccggcgtgcagctg
tacaccggcaacttcctggatggcagcattcacggcaagggcggcaaggtctatccgcac
tggggcgctttcacgctggaaacccagcactaccctgacgcgcccaaccagccgaaattc
cccagcacgcgactggacccaggcaaagcctacacccagaccactgtgttcaaattcctg
aacaactga

DBGET integrated database retrieval system