KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2719Help
Entry
PSPTO_2719        CDS       T00118                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00071  Fatty acid degradation
pst00280  Valine, leucine and isoleucine degradation
pst00281  Geraniol degradation
pst00310  Lysine degradation
pst00360  Phenylalanine metabolism
pst00362  Benzoate degradation
pst00380  Tryptophan metabolism
pst00410  beta-Alanine metabolism
pst00627  Aminobenzoate degradation
pst00640  Propanoate metabolism
pst00650  Butanoate metabolism
pst00903  Limonene and pinene degradation
pst00930  Caprolactam degradation
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01212  Fatty acid metabolism
Module
pst_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPTO_2719
   00650 Butanoate metabolism
    PSPTO_2719
  Lipid metabolism
   00071 Fatty acid degradation
    PSPTO_2719
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPTO_2719
   00310 Lysine degradation
    PSPTO_2719
   00360 Phenylalanine metabolism
    PSPTO_2719
   00380 Tryptophan metabolism
    PSPTO_2719
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPTO_2719
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSPTO_2719
   00281 Geraniol degradation
    PSPTO_2719
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPTO_2719
   00627 Aminobenzoate degradation
    PSPTO_2719
   00930 Caprolactam degradation
    PSPTO_2719
Enzymes [BR:pst01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSPTO_2719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 1184373
NCBI-ProteinID: NP_792525
UniProt: Q882B0
Position
3018617..3019429
Genome map
AA seq 270 aa AA seqDB search
MSDYQSFRFELADSIAHVQINRPEKLNAMNDAFWTEIIEIFDWIERNDEVRVVVLSGAGK
HFSSGIDLALLASVASQMGKDPGRNARLLRRKIRDMQASFTAVDTCRKPVLAAIQGYCLG
GAIDLISACDMRYAAADAQFAIREIDMGMAADVGTLQRLPRIIGDGVLRELAYTGRTVGA
EEAQRIGLVNRTFDDTEGLLQGVFAVAREIAEKSPLAIEGTKQMISYMRDHRVEDGLEHV
AIWNAAMLQSPDLKLAMVAQMSKHKPVFDN
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgattatcagagtttccggttcgagctggctgacagtattgctcacgtacagata
aaccggcctgaaaagctcaatgccatgaatgacgcgttctggaccgaaatcatcgagata
ttcgactggatcgagcgcaacgatgaagtgcgcgtggtggtgctcagcggcgcgggcaag
catttttcctcgggtatcgatctggccttgctggcgtcggtcgccagccagatgggcaag
gatcccggacgcaacgcgcggctgttgaggcgcaagattcgtgacatgcaggcgtcgttc
actgccgtggacacgtgccgcaagccggtactcgccgccattcagggttattgcctgggc
ggtgccatcgacctgatctcggcctgcgacatgcgttatgccgccgctgatgcgcagttt
gccattcgcgagatcgacatgggcatggctgccgatgtagggacattgcaacggttgccg
aggatcatcggcgacggtgtgctgcgtgaactggcgtacaccgggcgcaccgtcggtgcc
gaggaagcgcagcgcattggcctggtcaatcgcaccttcgatgacaccgaaggtctcttg
cagggcgtatttgcggtggcgcgggagatagccgaaaaatccccgctggccatcgaaggc
accaagcaaatgatcagctatatgcgtgaccacagggtcgaagacggccttgaacacgtt
gccatctggaacgcagccatgctgcaatcacctgacctgaaactggcaatggttgcgcag
atgagcaagcacaagccggtctttgataattga

DBGET integrated database retrieval system