KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_2762Help
Entry
PSPTO_2762        CDS       T00118                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PSPTO_2762 (glgB)
Enzymes [BR:pst01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PSPTO_2762 (glgB)
Exosome [BR:pst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPTO_2762 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
3079691..3081916
Genome map
AA seq 741 aa AA seqDB search
MNAPDKTGTDRRAVPAAVDLDALIRAEHRDPFSILGPHDDGKGGQYVRAYLPAALSVRLL
ARDDGRELAELHMSDVPGFFVGHLEQPQPYLLKINWAGGEQITEDPYSYGPLLGEMDLYL
FAEGNHRDLSSCLGAQVTSVDGVEGVRFAVWAPNARRVSVVGSFNGWDGRRHPMRLRHPT
GVWEIFVPRLQPGEVYKYEILGAHGILPLKSDPMALATTLPPDTASKISAPLKFEWHDQD
WLQSRAGRHDVAAPLSIYELHAGSWQMEQNDEGQWRQYNWRELADRLIPYVKELGFTHIE
LMPIMEHPFGGSWGYQLLAQFAPTARYGSPEDFAAFVDACHQAEIGVILDWVPAHFPTDT
HGLAQFDGTALYEYADPKEGFHQDWDTLIYNLGRTEVHGFMLASALHWLKHYHIDGLRVD
AVASMLYRDYSRKAGEWVPNRFGGRENLEAIDFLRHLNDVVALEAPGTMVIAEESTAWPG
VSESTQKGGLGFNYKWNMGWMHDSLQYMEEDPINREHHHGKLSFSLVYAWSERFVLPISH
DEVVHGKHSLIDKMPGDRWQKFANLRAYLAFMWTHPGKKLLFMGCEFGQWREWNHDEQLD
WYLMQYAEHVGVKKLVGDLNRIYREEKALHQRDADPTGFQWLIGDDKSNSVFAYLRWSND
GEPLLVVANMTPVPREGYRVGVPLQGAWTELLNSDAETYAGSNIGNGGEVISEDEPVHGM
SASLTLNLPPLAVLIFKPKKG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcgcctgacaaaaccggcacggatcgccgtgcggttcccgctgctgtggacctt
gatgcgctgattcgtgcagaacaccgtgacccgttttcgattcttggcccgcatgacgac
ggcaaaggcgggcaatatgttcgtgcctatctgcccgcagcgctgagcgtacgcctgctg
gccagagatgacggccgcgaactggccgaactgcacatgagcgacgtgccgggttttttc
gtcggtcatcttgagcagccacagccgtatctgttgaaaatcaactgggcgggcggcgag
cagatcaccgaagacccctacagctatggtccgctgctgggcgaaatggacctttacctg
tttgccgaaggcaatcaccgcgatctgagcagttgcctgggcgcgcaagtgaccagcgtt
gacggtgtcgagggtgtgcgcttcgctgtctgggcaccgaacgcccgccgggtttccgtg
gtcggcagcttcaatggctgggatggccgtcgccacccgatgcgtctgcgtcacccgacc
ggcgtgtgggagatctttgttccgcgtctgcaaccgggcgaggtctacaaatacgagatt
ctgggtgctcacgggattctgccgctcaagagcgacccgatggccctggccactacgctg
ccgcccgatacggcgtcgaagatttctgcgccactgaagttcgagtggcatgaccaggac
tggctgcaatcccgggccgggcgtcacgacgttgctgcgccattgtcgatttatgagctg
catgccggttcgtggcagatggaacagaacgatgaaggccaatggcgtcagtacaactgg
cgtgagttggctgaccgcttgatcccgtacgtcaaagagctgggtttcacgcacatcgag
ctgatgccgatcatggagcacccgttcggtggttcatggggctatcaattgctcgcccag
ttcgcgccgaccgcccgctacggttcgcctgaagatttcgccgctttcgtggacgcctgt
caccaggcagaaatcggcgtcatcctcgactgggtgcctgcgcatttcccgaccgatacc
cacgggctggcacaattcgacggcactgcgctgtacgaatacgctgaccccaaggaaggc
tttcatcaggattgggacacgctgatctacaacctggggcggaccgaagtgcatggcttc
atgctggcctcggcgctgcactggctcaagcattaccacatcgacggcctgcgtgtggat
gcggtggcgtcgatgctgtatcgcgactactcgcgcaaggcgggcgagtgggtgcccaat
cgcttcggcggccgcgagaacctggaggccatcgacttcctgcgtcacctcaacgacgtc
gttgcgctggaagcgcctggcactatggtcatcgctgaagaatcgacggcctggccgggc
gtcagcgaatcgacgcaaaaaggtggtttgggcttcaactacaagtggaacatgggctgg
atgcatgattcgcttcaatacatggaagaagacccgatcaaccgcgagcatcatcacggc
aaactgagtttcagcctggtatacgcgtggtccgagcgctttgtgctgccgatttcccac
gatgaagtggtgcacggcaagcattcgctgatcgacaagatgccgggtgatcgctggcag
aaatttgccaacctgcgcgcctatctggcgttcatgtggacgcatccgggcaagaagctg
ttgttcatgggctgcgaattcggccagtggcgtgagtggaaccatgacgagcaactggac
tggtacctgatgcaatacgccgagcacgtgggtgtcaagaagctggtcggtgacttgaac
cgcatttaccgcgaagagaaggccctgcaccagcgcgatgccgacccgaccggtttccag
tggttgatcggcgacgacaagtccaacagtgtgtttgcctatttgcgctggagcaatgat
ggcgaaccgctgctggtggtcgccaacatgacgcccgtgccgcgtgaaggctatcgcgtt
ggggtgccgttgcagggcgcgtggacagaactgctgaacagcgatgcagaaacctatgcc
ggctccaacatcggtaacggtggggaagtaatcagcgaagacgagccggttcatggcatg
tcggcttctctgacactgaatctgccaccattggccgtgctgattttcaagcccaaaaaa
ggctga

DBGET integrated database retrieval system