KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3113Help
Entry
PSPTO_3113        CDS       T00118                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PSPTO_3113 (galU)
   00052 Galactose metabolism
    PSPTO_3113 (galU)
   00500 Starch and sucrose metabolism
    PSPTO_3113 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    PSPTO_3113 (galU)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PSPTO_3113 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3500226..3501065)
Genome map
AA seq 279 aa AA seqDB search
MIKKCLFPAAGYGTRFLPATKAMPKEMLPVVNKPLIQYGVEEALAAGLTEISIVTGRGKR
SLEDHFDISYELEHQIKGTDKEKYLVGIRKLIDECSFSYTRQTEMKGLGHAILSGRPLIG
NEAFAVVLADDLCVNLEGDGVLAQMVKLHKHYGCSIIAIQEVDPSETNKYGVIAGEEIKP
GLFRVTDMVEKPKPEDAPSNLAIIGRYILTPDIFEKIEQTEPGKGGEIQITDALMKQAAE
GNVLAYKFKGTRFDCGGAEGYIEATNFCFEHFYKAGKAH
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgatcaagaaatgcttgttcccagcagccggttacggcactcgcttcctcccagcgacc
aaggccatgcccaaggaaatgctgccggtggtcaacaagccactgatccagtacggtgtt
gaagaagcgctcgcggcaggtctgaccgaaatttccatcgtgactggccgtggcaagcgc
tctcttgaagatcactttgacattagctacgagcttgagcatcagatcaaaggcactgac
aaagagaagtatctggtcggtattcgcaaattgatcgacgagtgcagcttctcctacacg
cgtcagaccgaaatgaagggcctgggccacgctatcctcagcggtcgtccgctgatcggc
aacgaagcgtttgccgtagtgctggccgatgacttgtgcgtcaaccttgaaggcgacggc
gtgctggcgcagatggtcaagctgcacaagcactatggctgctcgatcattgccattcag
gaagtcgatccgtcggaaaccaacaagtacggcgtcatcgctggcgaagagatcaagcca
ggcttgttccgcgtgaccgacatggtcgaaaagccgaagcctgaagatgcaccgtccaac
ctggcgatcatcggccgttacattctgacgccggacatcttcgaaaaaatcgaacagacc
gagccaggcaagggtggtgagatccagatcactgacgccctgatgaagcaggcagcggaa
ggtaacgtgctggcctacaagttcaagggcacgcgctttgactgtggcggcgctgaaggc
tacatcgaagcgaccaacttctgcttcgaacatttctacaaagctggcaaagcgcattga

DBGET integrated database retrieval system