KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3148Help
Entry
PSPTO_3148        CDS       T00118                                 

Definition
magnesium chelatase, subunit ChII
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pst00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(3536337..3537365)
Genome map
AA seq 342 aa AA seqDB search
MTLPDSSLSDTAHFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLAD
LLASGQFVTLPLGATEERLVGTLDLDAALAEGRARFSPGVLAKADGGVLYVDEVNLLADH
LVDLLLDVAASGVNLVERDGISHRHAARFVLIGTMNPEEGELRPQLLDRFGLNVALSGQT
LPVERSQIIRRRLDFDADPLSFCQHWQAQQDALKQRCEQARLLLPSIELDDHSLAVITER
CFAAGVDGMRADLVWLRAARAHAAWRSVGQIDEQDIEAVAEFALRHRRRDPAPPPQNQQA
EPPETSPKPDKPESGQGNWGELPAQAVVTGSRREVPSWPKKP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcctgattcaagcctgagcgacactgcgcatttccccttggccgccgtggtc
ggggccgacgacctgaaactggcgctgtgcctgaccgccatcgacccgcgtattggcgga
gtattgatcgaaggcccgcgtggcatggccaagtcgaccctggcgcgcggtctggctgat
ctgctggccagcggtcagttcgtcaccttgccgttgggcgcgaccgaagagcgtctggtc
ggcaccctggaccttgatgccgctctggccgagggccgcgcacgtttctctccgggtgtg
ctggccaaagctgacggcggggtgctgtacgtcgatgaagtcaacctgctcgccgatcat
ctggttgacctgctgctggacgttgccgccagtggcgtcaatctggtcgagcgcgacggt
atttcccatcgacacgcggcgcgtttcgtgctgattggcaccatgaacccggaagagggc
gagttgcgccctcaattgctggaccgttttggcctgaacgtggcactgagcggccagaca
ctgcccgtcgaacgcagccagatcatccgccgacgtctggattttgatgctgatcccctg
agtttttgtcagcactggcaggcgcagcaggacgccttgaagcagcgttgcgagcaggcg
cgtctgctactgccgagcattgagctggatgatcattcgttggcggtgattaccgagcgc
tgctttgcagccggggttgatggcatgcgtgcagacctggtctggctaagggctgcacgc
gctcatgccgcctggcgcagtgttggccagatcgacgagcaggacatcgaagccgttgct
gaatttgccctacgccacaggcgccgcgacccggctccgccgccgcagaatcagcaagct
gagccgcctgaaacgtctcccaagccagacaagcccgagagcgggcagggcaattggggc
gagttacccgcacaggcggtggttaccggatcgcgccgcgaagtgccgagctggccaaaa
aagccctag

DBGET integrated database retrieval system