KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3148Help
Entry
PSPTO_3148        CDS       T00118                                 

Definition
(RefSeq) magnesium chelatase, subunit ChII
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00860  Porphyrin and chlorophyll metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PSPTO_3148
Enzymes [BR:pst01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PSPTO_3148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase MCM Sigma54_activat AAA_16 AAA Caskin-Pro-rich RuvB_N NACHT AAA_3
Motif
Other DBs
NCBI-GeneID: 1184805
NCBI-ProteinID: NP_792940
UniProt: Q880K7
Position
complement(3536337..3537365)
Genome map
AA seq 342 aa AA seqDB search
MTLPDSSLSDTAHFPLAAVVGADDLKLALCLTAIDPRIGGVLIEGPRGMAKSTLARGLAD
LLASGQFVTLPLGATEERLVGTLDLDAALAEGRARFSPGVLAKADGGVLYVDEVNLLADH
LVDLLLDVAASGVNLVERDGISHRHAARFVLIGTMNPEEGELRPQLLDRFGLNVALSGQT
LPVERSQIIRRRLDFDADPLSFCQHWQAQQDALKQRCEQARLLLPSIELDDHSLAVITER
CFAAGVDGMRADLVWLRAARAHAAWRSVGQIDEQDIEAVAEFALRHRRRDPAPPPQNQQA
EPPETSPKPDKPESGQGNWGELPAQAVVTGSRREVPSWPKKP
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaccttgcctgattcaagcctgagcgacactgcgcatttccccttggccgccgtggtc
ggggccgacgacctgaaactggcgctgtgcctgaccgccatcgacccgcgtattggcgga
gtattgatcgaaggcccgcgtggcatggccaagtcgaccctggcgcgcggtctggctgat
ctgctggccagcggtcagttcgtcaccttgccgttgggcgcgaccgaagagcgtctggtc
ggcaccctggaccttgatgccgctctggccgagggccgcgcacgtttctctccgggtgtg
ctggccaaagctgacggcggggtgctgtacgtcgatgaagtcaacctgctcgccgatcat
ctggttgacctgctgctggacgttgccgccagtggcgtcaatctggtcgagcgcgacggt
atttcccatcgacacgcggcgcgtttcgtgctgattggcaccatgaacccggaagagggc
gagttgcgccctcaattgctggaccgttttggcctgaacgtggcactgagcggccagaca
ctgcccgtcgaacgcagccagatcatccgccgacgtctggattttgatgctgatcccctg
agtttttgtcagcactggcaggcgcagcaggacgccttgaagcagcgttgcgagcaggcg
cgtctgctactgccgagcattgagctggatgatcattcgttggcggtgattaccgagcgc
tgctttgcagccggggttgatggcatgcgtgcagacctggtctggctaagggctgcacgc
gctcatgccgcctggcgcagtgttggccagatcgacgagcaggacatcgaagccgttgct
gaatttgccctacgccacaggcgccgcgacccggctccgccgccgcagaatcagcaagct
gagccgcctgaaacgtctcccaagccagacaagcccgagagcgggcagggcaattggggc
gagttacccgcacaggcggtggttaccggatcgcgccgcgaagtgccgagctggccaaaa
aagccctag

DBGET integrated database retrieval system