KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3164Help
Entry
PSPTO_3164        CDS       T00118                                 

Gene name
phbA-2
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPTO_3164 (phbA-2)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPTO_3164 (phbA-2)
   00640 Propanoate metabolism
    PSPTO_3164 (phbA-2)
   00650 Butanoate metabolism
    PSPTO_3164 (phbA-2)
  Lipid metabolism
   00071 Fatty acid degradation
    PSPTO_3164 (phbA-2)
   00072 Synthesis and degradation of ketone bodies
    PSPTO_3164 (phbA-2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPTO_3164 (phbA-2)
   00310 Lysine degradation
    PSPTO_3164 (phbA-2)
   00380 Tryptophan metabolism
    PSPTO_3164 (phbA-2)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSPTO_3164 (phbA-2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPTO_3164 (phbA-2)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSPTO_3164 (phbA-2)
Enzymes [BR:pst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSPTO_3164 (phbA-2)
Exosome [BR:pst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPTO_3164 (phbA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(3556756..3557964)
Genome map
AA seq 402 aa AA seqDB search
MSIERTIPHHDPVVIVSAARTPMGGFQGDLQSLGATRLGSIAIRAAVERAAIAPGDVEHV
LFGCVLPAGCGQAPARQAALGAGLSTGTLCSTVNKMCGSGMQTAIMAHDLLMADAATVVV
AGGMESMSNAPYLLDRARSGYRMGHGKVLDHMFLDGLEDAYEPGRLMGTFAEDCAQRHAL
SREAQDAFALASLARAQQAITDGHFDAEIVPVQVTVGKESRHITHDEQPPKARPDKIPTL
KPAFRDGGTVTAANSSSISDGAAALLLMRQSQAQRRGLQPLAIFHAHAGFADEPGLFPTA
PIGAIQRLLGKTGWALDDVDLFEINEAFAVVPMVAMSELGIPHEKVNVNGGACALGHPIG
ASGARIIVTLLAALRRRQLKRGLAAICIGGGEATAVAIELVY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcgagaggacaatccctcatcacgaccctgtggtcattgtcagcgcagcgcgc
acgcccatgggtggttttcagggcgacttgcagagccttggcgcgacccggctggggtcg
attgccatccgtgccgccgtcgaacgcgccgccattgccccgggtgacgtagagcacgtg
ctgtttggttgcgtgctgccggcgggttgtggccaggcgcctgcccggcaagcggccttg
ggtgcagggttgagcaccggcacgttgtgcagcacggtcaacaagatgtgcggctcgggg
atgcagaccgccattatggcccatgatttgctgatggccgacgctgccaccgtggtggtg
gccgggggcatggagagcatgtccaatgcgccttatctgctcgaccgcgcgcgcagcggt
tatcgcatggggcacggcaaggtgctggaccacatgtttctcgacggccttgaagatgcc
tatgagccaggccgactgatgggcaccttcgccgaagactgtgctcagcgccatgctttg
agccgcgaagcgcaggacgcgttcgctctggcatcactggcccgcgcgcagcaggccatc
accgacgggcacttcgatgccgagattgttccggtgcaggtcacggtgggcaaagaatcc
aggcacatcacccatgacgagcagccgcccaaggcgcgtccagacaagatcccgacactc
aaaccggcgtttcgcgacggcggtacggtcacggcagccaactccagttccatctccgat
ggcgcagcggcgctattgttgatgcgtcagtcacaagcgcagcgccgaggcttgcagccg
ctggccatattccacgcccatgcaggcttcgccgacgaaccggggctgtttccgacagcg
cccatcggggccattcagcgcctgctgggcaagacaggctgggcactggatgacgtcgat
ctgttcgagatcaacgaggcattcgcagttgtgccgatggtggccatgagcgagctgggt
atcccgcacgagaaggtcaacgtcaatggcggcgcctgtgcactgggtcacccgataggg
gcttcgggcgcgcggatcattgtcacgttgctggcagccttgcggcgcaggcagctcaag
cgtgggttggcagcaatctgcattggtggtggtgaagcgaccgctgttgctattgaattg
gtttattaa

DBGET integrated database retrieval system