KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3364Help
Entry
PSPTO_3364        CDS       T00118                                 

Gene name
aceA
Definition
(RefSeq) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00630  Glyoxylate and dicarboxylate metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PSPTO_3364 (aceA)
Enzymes [BR:pst01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PSPTO_3364 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 1185023
NCBI-ProteinID: NP_793147
UniProt: Q87ZR0
Position
3802047..3803372
Genome map
AA seq 441 aa AA seqDB search
MALTREQQIAALEKDWAENPRWKNVTRTYSAADVVRLRGSVQPEHTFARLGADKLWNLVT
QGARPSFRPDKDFVNCMGALTGGQAVQQVKAGIQAIYLSGWQVAADNNSAESMYPDQSLY
PVDSVPTVVKRINNSFRRADQIQWKAGKTPGDEGYIDYFAPIVADAEAGFGGVLNAYELM
KNMIEAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVAGVPTIILAR
TDANAADLLTSDCDPYDKAFVTGERTHEGFYKVRAGLDQAISRGLAYAPYADLIWCETAK
PDLDEARRFAEAIKKEYPDQLLSYNCSPSFNWKKNLDDATIAKFQRELSAMGYKHQFITL
AGIHNMWYSMFNLAHDYARNDMTAYVKLQEQEFADAAKGYTFVAHQQEVGTGYFDDMTTV
IQGGVSSVTALTGSTEEEQFH
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atggcactgacacgcgaacaacaaatagcggctctcgaaaaagactgggccgaaaatccg
cgctggaaaaacgtcacccgtacctactctgcagccgatgtagtccgcttgcgtggctcg
gttcaacccgagcacaccttcgcaagactgggcgcggacaaactgtggaatctggtgacc
caaggtgccaggccctcttttcgaccggacaaggacttcgtcaactgcatgggcgctctg
accggcggtcaggccgtgcagcaggtcaaggccggcattcaggcgatttacctttccggc
tggcaagtggctgccgacaacaactctgccgaatccatgtacccggatcagtcgctgtac
ccggtcgactcggtgccgacggtggtcaagcgcatcaacaactcattccgacgtgctgac
cagattcaatggaaagccggtaaaacgccgggcgacgaaggctacatcgactacttcgca
cccatcgtggcggatgccgaggcaggctttggtggcgtgctgaatgcgtacgagctgatg
aaaaacatgatcgaggccggtgcagcgggtgtgcacttcgaagatcagttggcatcggtt
aagaaatgcgggcacatgggtggcaaggtgctggttccgactcaggaggcgatccagaaa
ctggtggctgcgcgcctggcggccgacgtcgccggtgtgcccacgattattctggcgcgc
accgacgccaacgccgccgacctgctgacctcggactgcgacccttacgacaaggcgttc
gtgaccggcgagcgcactcacgagggcttctacaaggtccgcgcgggcctggatcaggcg
atttctcgcggcctggcctatgcaccttatgccgacctgatctggtgtgaaaccgccaaa
ccggatctggacgaggcgcgtcgcttcgctgaagcgatcaagaaggagtacccggatcag
ttgctctcctacaactgctcgccctctttcaactggaagaaaaacctcgatgacgcgacc
atcgccaagtttcagcgcgagctttcggccatgggttacaagcaccagttcatcaccctg
gcaggcatccacaacatgtggtacagcatgttcaacctggcgcatgactacgcccgcaac
gacatgacggcgtacgtgaagctacaggaacaggagttcgccgacgcggccaaaggctac
acctttgtggcccaccagcaggaagtgggcaccggctatttcgatgacatgaccaccgtg
atccagggcggcgtgtcatcggtcaccgcgctgactggctccacagaagaagagcaattc
cactga

DBGET integrated database retrieval system