KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3507Help
Entry
PSPTO_3507        CDS       T00118                                 

Gene name
nagZ
Definition
(RefSeq) beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00520  Amino sugar and nucleotide sugar metabolism
pst01100  Metabolic pathways
pst01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    PSPTO_3507 (nagZ)
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    PSPTO_3507 (nagZ)
Enzymes [BR:pst01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     PSPTO_3507 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-GeneID: 1185172
NCBI-ProteinID: NP_793287
UniProt: Q87ZC2
Position
complement(3959286..3960296)
Genome map
AA seq 336 aa AA seqDB search
MSSGLQGSLMVDVAGTWLTSEDRQFLRQPEVGGLIIFARNIEHPRQVRELSAAIRAVRPD
LLLAVDQEGGRVQRLRQGFVRLPPMRAIADKPEALLLAEHCGWLMATEVLAVGLDLSFAP
VLDLDYQRSAVVGTRAFEGDPERAALLAGAFIRGMNAAGMAATGKHFPGHGWAEADSHVA
IPNDERSLEQIRANDLVPFARLSQQLAAVMPAHVIYPKVDSQPAGFSRRWLQDILRDELK
FDGVIFSDDLSMAGAHVVGDAASRIEAALTAGCDMGLVCNDRAAAELALIAAQRLKVKPS
PRIARMRGQASASTDYRQHPRWQAALQALRTAQLID
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagttctggcctgcaaggctccctgatggtcgatgtcgccggtacctggctgaccagc
gaagaccgtcagtttctgcgtcagcccgaagtgggcggcttgatcatctttgcccgcaac
atcgagcatccgcgtcaggttcgtgagctgagcgcagcgattcgcgccgttcgcccggac
ctcctgctggcagtggaccaggagggcgggcgggttcagcgcctgcgtcaggggttcgtg
cggctgccgccgatgcgcgccatcgctgacaagcctgaggcgctgctgctggccgaacat
tgcggttggctgatggccaccgaagtgctggcggtcgggctggacctcagttttgccccg
gttctggatctggactatcagcgcagcgcggtggtaggcacgcgcgcgttcgagggcgat
ccggagcgtgcagcgttgctggcgggtgctttcattcgtggcatgaacgcagcaggcatg
gccgcgaccggcaagcattttcccggccacggctgggcggaagccgactctcatgtggcc
attccgaatgacgagcgcagcctggagcagattcgcgccaacgacctggtgccctttgcg
cgcctgagtcagcaactggcggcagtcatgccggcgcatgtcatctacccgaaagtcgat
tcgcagcccgccggtttttcaaggcgctggttgcaggacatcctgcgcgacgaactgaaa
ttcgacggtgttattttcagtgacgacctgtcgatggccggcgcccacgtggtgggtgat
gcggccagccgcatcgaagcggcgctgactgcgggctgcgacatggggctggtgtgcaac
gaccgtgcagccgcagagctggcactaattgcggctcagcgcttgaaggtcaagccttcg
ccgcgcatcgcccgcatgcggggtcaggcgtctgccagtaccgattatcggcaacacccg
cgctggcaggccgcgcttcaggcgctacgcacggctcaactgattgattaa

DBGET integrated database retrieval system