KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3517Help
Entry
PSPTO_3517        CDS       T00118                                 

Gene name
fadB
Definition
(RefSeq) multifunctional fatty acid oxidation complex subunit alpha
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00071  Fatty acid degradation
pst00280  Valine, leucine and isoleucine degradation
pst00281  Geraniol degradation
pst00310  Lysine degradation
pst00362  Benzoate degradation
pst00380  Tryptophan metabolism
pst00410  beta-Alanine metabolism
pst00640  Propanoate metabolism
pst00650  Butanoate metabolism
pst00903  Limonene and pinene degradation
pst00930  Caprolactam degradation
pst01040  Biosynthesis of unsaturated fatty acids
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01200  Carbon metabolism
pst01212  Fatty acid metabolism
Module
pst_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    PSPTO_3517 (fadB)
   00650 Butanoate metabolism
    PSPTO_3517 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    PSPTO_3517 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    PSPTO_3517 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSPTO_3517 (fadB)
   00310 Lysine degradation
    PSPTO_3517 (fadB)
   00380 Tryptophan metabolism
    PSPTO_3517 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSPTO_3517 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    PSPTO_3517 (fadB)
   00281 Geraniol degradation
    PSPTO_3517 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSPTO_3517 (fadB)
   00930 Caprolactam degradation
    PSPTO_3517 (fadB)
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     PSPTO_3517 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     PSPTO_3517 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     PSPTO_3517 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     PSPTO_3517 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 1185182
NCBI-ProteinID: NP_793297
UniProt: Q87ZB2
Position
complement(3967722..3969887)
Genome map
AA seq 721 aa AA seqDB search
MIYEGKAITVKALESGIVELNFDLKGESVNKFNRLTLNELRQAVDAVKADASVKGVIVTS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFSDFEDLGVPTVVAINGIALGGGLE
MCLAADYRVISSSARVGLPEVKLGLYPGFGGTVRLPRIIGADNAIEWIASGKENSAEDAL
KVGVVDAIVAPEKLQAAALDLIQRAISGEFDYKAKRQPKLDKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAAIFGRDKALEIEAAGFVKMAKTSAAQSLIGLFLNDQEL
KKKAKGYDEVARDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGGRLEKGRLTAAKMAEALNAIRPTLSYGDFGNVDLVVEAVVENPKVKQAVLAEVEANVG
ENTILASNTSTISISLLAQALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEEAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFARLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDDRRSAVDALYEANRLGQKNGKGFYVYETDKKGKP
KKVNDPAVLDVLKPIVYEQREVSDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLIY
GIGFPPFRGGALRYIDSIGVAEFVALADRYAELGALYQPTAKLREMAANGQSFFGQASSE
V
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgatttacgaaggtaaagccatcacggttaaggctcttgaaagtggcatcgtcgaattg
aatttcgacctcaagggtgagtccgtcaacaagttcaaccgcctcaccctcaacgagttg
cgtcaggcggtcgacgccgtcaaggccgacgcatcggtcaagggcgtgatcgtcaccagc
ggcaaggacgtgttcatcgtcggtgccgacatcaccgagttcgtcgacaacttcaagttg
ccggaagccgaactggttgcgggcaatctggaagccaacaggattttcagcgatttcgaa
gacctgggcgtgcccaccgttgtcgccatcaacggcattgcgctgggtggtggtctggaa
atgtgcctggccgcagactatcgagtcatctccagcagcgcccgtgtcggcctgccggaa
gtcaagctgggcctgtatccaggtttcggcggtaccgtgcgcctgccgcgcatcatcggc
gccgacaatgctatcgaatggatcgcatcgggcaaggaaaactccgcagaagacgcgctt
aaagtcggtgttgtcgatgcaatagtggctcccgagaagcttcaggccgcagcgcttgac
cttatccagcgcgctatttccggcgagttcgattacaaggccaagcgtcaaccaaagctg
gacaagctcaaactgaacgccatcgagcagatgatggcattcgagaccgccaagggtttt
gtcgcaggtcaagccgggccgaattacccggcgccggtcgaagccatcaagaccatccag
aaagccgccatctttggccgtgacaaggcactggaaatcgaagccgccggtttcgtgaaa
atggccaagacttcggccgcgcagagcctgatcggcctgttcctgaatgatcaggagctg
aaaaagaaagccaagggctacgacgaagtggctcgcgacgtgaaacaggccgccgtgctg
ggggccgggatcatgggcggcggtattgcctatcagtctgcggtcaagggcacgccgatc
ctgatgaaggacatccgcgaagaagccattcaactgggcctgaacgaagcctccaagctg
ctgggcggtcgccttgaaaaaggccgtctgaccgctgcgaagatggcagaagcgctaaac
gcgattcgtcctacgctgtcctacggcgatttcggcaatgtcgacctggtggttgaagcg
gttgtcgaaaaccccaaggtcaaacaggccgtactcgctgaagtcgaagccaacgtcggt
gaaaacaccattctggcttccaacacctcgaccatttccatcagcctgttggcgcaagcg
ctcaagcgcccggaaaacttcgtcggcatgcacttcttcaatccggtgcacatgatgccg
ctggtggaagtgatccgtggcgagaagtccagcgaagaggctgtcgccaccaccgttgcc
tatgccaagaaaatgggcaagaacccgattgtggtcaacgactgcccgggctttctggtc
aatcgcgtgctgttcccgtacttcggcggtttcgccagactggtcagcgcgggcgtggat
ttcgtgcgcatcgacaaggtcatggaaaaattcggctggccgatgggccctgcgtacctg
atggacgttgtcggcatcgacaccggccaccacggccgtgacgtgatggctgaaggcttc
cccgaccgcatgaaagacgaccgtcgttctgccgttgacgcgttgtatgaagccaatcgt
ctgggccagaagaacggcaagggcttctatgtctacgagaccgacaagaagggcaagccc
aagaaggtcaacgatccggcggtgctggacgtgctcaagccgattgtctacgagcagcgt
gaagtcagcgatgaagacatcatcaactggatgatgatcccgctgtgcctggaaaccgtt
cgctgcctggaagacggcatcgtcgaaacggctgccgaagctgacatgggcctgatctac
ggtattggtttccctccattccgtggcggtgcgctgcgctacatcgattccatcggtgtt
gccgaattcgttgccctggccgatcgatatgccgagctgggtgccctgtatcaaccgacc
gcaaagctgcgtgagatggccgccaatggccagagcttcttcggtcaagcgtcttccgag
gtatga

DBGET integrated database retrieval system