KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3559Help
Entry
PSPTO_3559        CDS       T00118                                 

Gene name
glcB-2
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PSPTO_3559 (glcB-2)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSPTO_3559 (glcB-2)
   00630 Glyoxylate and dicarboxylate metabolism
    PSPTO_3559 (glcB-2)
Enzymes [BR:pst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     PSPTO_3559 (glcB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4016048..4018225
Genome map
AA seq 725 aa AA seqDB search
MTDFVKCQRLKVAVKLQRFVDEEVLPGTGLEPEAFWKGFDALVHDLAPVNRELLAERERL
QGQLDKWHKAHPGPITDMPAYRAFLHSIGYLQPVPEHVAATTANVDLEISEQAGPQLVVP
ASNARYALNAANARWGSLYDALYGTDVISTSNGAEIRAGYNPLRGAKVIAFARELLDTSA
PLANGSHSDANRYRIEDGELRITLADGSQTLLQHPEKYVGFTGEPDQPQAILLKNHGLHI
EIQFDPQHPVGKTDAAGIKDLLLESALSTIVDCEDSVAAVDADDKVLVYRNWLGLMKGDL
TETLDKGGKAITRSLNPDRVYHAAAGGELTLRGRSLLLIRNVGHLMSNPAIVDQDDKEIP
EGILDGVITSLIGLHDLTRHGNSRAGSIYIVKPKMHGAAEVAFADQLFSRIEDVLHLPRN
TLKMGIMDEERRTSVNLKACINAASARVAFINTGFLDRTGDEIHSAMQAGPVLRKGEMKN
TPWIKAYERNNVQVGLACGLRGRAQIGKGMWAMPDRMADMLEQKIAHPKSGATTAWVPSP
TAATLHAWHYHHVDVRQVQEQLEQQSLVDVSDQWLDDLLTIPVVGKPEWTREQILEELEN
NTQGLLGYVVRWVEQGIGCSKVPDIHNVGLMEDRATLRISSQHMANWLLHDIAGKEDIQN
VLERMAKVVDKQNAGDSHYRPMTRDFKNSAAFKAACALVFKGTEQPSGYTEPLLHESRLA
FKDAH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcgtcaaatgccaacgcctcaaggtagccgtcaagctgcaacgttttgtc
gatgaagaagtgctgcccggcaccgggctggagccagaggcattctggaaaggcttcgat
gcgctggttcatgaccttgcgccagtcaatcgcgaactgctcgccgaacgtgagcgtttg
cagggccaactggacaaatggcacaaggcgcatcccggaccaatcaccgacatgcccgcc
taccgtgcgtttctgcactcgattggctacctgcagcccgtgccggaacacgttgcagcc
actaccgccaatgtcgatctggaaatcagcgagcaggctggcccgcaactggtggtgccc
gccagcaacgcacgctatgcgctgaatgctgccaatgcgcgctggggctcgctgtacgac
gcgctgtatggcaccgacgtgatctcgaccagcaacggcgctgaaatccgcgccgggtac
aatccgctgcgcggcgccaaggtcatcgcgtttgcccgcgagctgctcgacaccagtgcg
ccccttgctaacggcagccatagcgacgcaaaccgctatcgcattgaagatggcgagctg
cgcatcaccctggcggatggcagtcagacgcttctgcaacacccggaaaaatacgtcggt
ttcacaggtgagcctgaccagccacaggcgattctgctcaagaatcatggtctgcacatc
gaaatccaattcgatccgcagcatccggtcggcaagaccgatgccgccggcatcaaggac
ctgctgctggaatcggctctgtcgaccatcgtcgactgcgaagactcggtcgccgccgtt
gacgctgacgacaaggtgctggtctaccgcaactggctgggcctgatgaaaggcgacctg
accgaaaccctcgacaagggcggcaaagccatcacccgcagcctcaaccccgaccgcgtt
taccacgccgcagccggtggtgaactgacgctgcgcggtcgctcgctgctgttgattcgc
aacgtcggccacctgatgagcaacccggcgattgtcgaccaggacgacaaggagattccc
gagggcattctcgacggcgtgatcaccagcctgatcggcctgcacgacctgacccggcat
ggcaactcgcgcgccgggagcatttacatcgtcaaaccgaaaatgcacggcgcggccgaa
gtggcgtttgccgaccagttgttcagccgcatcgaggacgtgctgcacctgccacgcaac
accttgaagatgggcatcatggacgaagagcgacgcaccagcgtcaacctcaaggcctgt
atcaatgcggcgtctgctcgggtcgcgttcatcaacaccggttttctcgaccgtaccggc
gatgaaattcacagcgccatgcaggcaggccctgtgctgcgcaagggcgagatgaaaaac
acgccgtggatcaaggcctacgagcgcaacaatgtgcaggtcggcctggcctgcggcttg
cgcggcagggcgcagataggcaagggcatgtgggcgatgcccgatcgcatggccgacatg
ctggagcagaaaatcgctcatccgaaatcaggcgcgaccaccgcttgggtgccttcgccg
actgccgccacactgcatgcgtggcattaccatcatgtcgatgtgcgtcaggttcaggag
caactcgagcaacagtcactggtcgatgtcagcgatcagtggctcgacgacctgctgacc
attcccgtggtgggcaaacccgagtggacacgcgaacagattctcgaagaactggaaaat
aacacccagggcctgctgggctatgttgtacgctgggtggagcaaggtatcggctgctcc
aaggtgccggatatccataacgtcgggctgatggaagaccgggcgaccctgcgcatctcc
agccagcacatggccaactggttgctgcacgacatcgcaggcaaggaagacatacaaaat
gtgctggagcgcatggccaaagtggtggacaagcagaatgccggggattcgcactaccgg
ccgatgaccagggacttcaagaactccgccgccttcaaggccgcctgcgcgctggtattc
aaaggcacggagcagccttcgggctacaccgagcccctgctgcatgagtcccggcttgcg
ttcaaggatgcccactga

DBGET integrated database retrieval system