KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3638Help
Entry
PSPTO_3638        CDS       T00118                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pst00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSPTO_3638 (recR)
DNA repair and recombination proteins [BR:pst03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSPTO_3638 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4097544..4098146)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDAFRVLPGVGQKTAQRMALQLLERDRSGGSRLALALGQAMDGVGHCRLC
RTLTEEELCPQCSDLRRNDTLLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMERISQQATFTEVILATNPTVEGEATAHYIAQLLHDKGLVASRIAHGVPLGGEL
DLVDGGTLAHSFAGRKPIAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgattcgccagttgatcgatgccttccgcgtgctgccgggcgta
ggtcagaaaaccgcgcaacgcatggcgttgcagctgctggagcgcgaccgcagcggcggt
tcgcggctggcattggcgttggggcaggcaatggatggcgtcggtcattgccgcttgtgc
cgcacgctgaccgaagaagagctctgcccgcagtgttccgacctgcgtcgcaatgacacc
ctgctgtgcgtggtcgaaggcccgacggatgtctatgcggtggagcagaccggttatcgc
ggtcgttatttcgtgctcaagggccacctgtcgcccctcgacggcctgggcccggaggcc
atcggcattccgcaactgatggagcgcatcagccagcaggccaccttcacggaagtgatt
ctggccaccaacccgaccgtggagggcgaggccaccgcgcactacatcgcccagttgctc
cacgacaaaggcctggtggcctcgcgcattgcccacggcgtgccgctgggtggcgagctg
gacctggttgacggcggcaccctggcgcactcgtttgccgggcgcaaaccgattgccttg
tga

DBGET integrated database retrieval system