KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3638Help
Entry
PSPTO_3638        CDS       T00118                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pst03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(4097544..4098146)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDAFRVLPGVGQKTAQRMALQLLERDRSGGSRLALALGQAMDGVGHCRLC
RTLTEEELCPQCSDLRRNDTLLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMERISQQATFTEVILATNPTVEGEATAHYIAQLLHDKGLVASRIAHGVPLGGEL
DLVDGGTLAHSFAGRKPIAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgattcgccagttgatcgatgccttccgcgtgctgccgggcgta
ggtcagaaaaccgcgcaacgcatggcgttgcagctgctggagcgcgaccgcagcggcggt
tcgcggctggcattggcgttggggcaggcaatggatggcgtcggtcattgccgcttgtgc
cgcacgctgaccgaagaagagctctgcccgcagtgttccgacctgcgtcgcaatgacacc
ctgctgtgcgtggtcgaaggcccgacggatgtctatgcggtggagcagaccggttatcgc
ggtcgttatttcgtgctcaagggccacctgtcgcccctcgacggcctgggcccggaggcc
atcggcattccgcaactgatggagcgcatcagccagcaggccaccttcacggaagtgatt
ctggccaccaacccgaccgtggagggcgaggccaccgcgcactacatcgcccagttgctc
cacgacaaaggcctggtggcctcgcgcattgcccacggcgtgccgctgggtggcgagctg
gacctggttgacggcggcaccctggcgcactcgtttgccgggcgcaaaccgattgccttg
tga

DBGET integrated database retrieval system