KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_3638Help
Entry
PSPTO_3638        CDS       T00118                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pst00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PSPTO_3638 (recR)
DNA repair and recombination proteins [BR:pst03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     PSPTO_3638 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      PSPTO_3638 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 Toprim_2 HHH
Motif
Other DBs
NCBI-GeneID: 1185303
NCBI-ProteinID: NP_793414
UniProt: Q87Z00
Position
complement(4097544..4098146)
Genome map
AA seq 200 aa AA seqDB search
MSFSPLIRQLIDAFRVLPGVGQKTAQRMALQLLERDRSGGSRLALALGQAMDGVGHCRLC
RTLTEEELCPQCSDLRRNDTLLCVVEGPTDVYAVEQTGYRGRYFVLKGHLSPLDGLGPEA
IGIPQLMERISQQATFTEVILATNPTVEGEATAHYIAQLLHDKGLVASRIAHGVPLGGEL
DLVDGGTLAHSFAGRKPIAL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcagccccctgattcgccagttgatcgatgccttccgcgtgctgccgggcgta
ggtcagaaaaccgcgcaacgcatggcgttgcagctgctggagcgcgaccgcagcggcggt
tcgcggctggcattggcgttggggcaggcaatggatggcgtcggtcattgccgcttgtgc
cgcacgctgaccgaagaagagctctgcccgcagtgttccgacctgcgtcgcaatgacacc
ctgctgtgcgtggtcgaaggcccgacggatgtctatgcggtggagcagaccggttatcgc
ggtcgttatttcgtgctcaagggccacctgtcgcccctcgacggcctgggcccggaggcc
atcggcattccgcaactgatggagcgcatcagccagcaggccaccttcacggaagtgatt
ctggccaccaacccgaccgtggagggcgaggccaccgcgcactacatcgcccagttgctc
cacgacaaaggcctggtggcctcgcgcattgcccacggcgtgccgctgggtggcgagctg
gacctggttgacggcggcaccctggcgcactcgtttgccgggcgcaaaccgattgccttg
tga

DBGET integrated database retrieval system