KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4168Help
Entry
PSPTO_4168        CDS       T00118                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    PSPTO_4168 (glpK)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    PSPTO_4168 (glpK)
Enzymes [BR:pst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     PSPTO_4168 (glpK)
Exosome [BR:pst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSPTO_4168 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4694720..4696225
Genome map
AA seq 501 aa AA seqDB search
MTDTQNKNYIIALDQGTTSSRAIIFDRDANVVSTAQSEFVQHYPQAGWVEHDPMEIFATQ
TACMTKALAQADLHHDQIAAIGITNQRETTVIWERDTGRPIYNAIVWQCRRSTEICQQLK
RDGLEEYIKDTTGLVLDPYFSGSKVKWILDHVEGSRERARKGELMFGTIDTWLIWKFTGG
KVHVTDYTNASRTMLFNIHTLEWDQRMLDVLDIPREILPEVKSSSEVYGHSKSGIPIAGI
AGDQQAALFGQMCVEPGQAKNTYGTGCFLLMNTGKKAVKSAHGMLTTIGCGPRGEVAYAL
EGAVFNGGSTVQWLRDELKLINDALDTEYFAGKVKDSNGVYLVPAFTGLGAPYWDPYARG
ALFGLTRGVKVDHIIRAALESIAYQTRDVLDAMQQDSGERLKSLRVDGGAVANNFLMQFQ
ADILGTHVERPQMRETTALGAAFLAGLAIGFWSSLDELRNKAVIERVFEPACEEAHREKL
YAGWQKAVARTRDWEPHENEE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgactgacacacagaacaagaactacatcattgctcttgaccagggcaccaccagctcg
cgcgccatcatcttcgaccgcgacgccaatgtggtgagcacggcccaaagcgaattcgtg
cagcattatccgcaggcaggctgggtcgagcatgacccgatggaaatcttcgccacgcag
acagcgtgcatgaccaaggcgctggcgcaggctgatctgcaccacgatcagatcgccgcc
atcggtatcaccaaccagcgtgaaaccaccgtcatctgggaacgcgacaccggccgccct
atctacaatgcgatcgtctggcagtgccgccgcagcaccgaaatctgtcagcagctcaag
cgtgacggccttgaggagtacatcaaggacaccacaggcctggtgcttgatccgtacttc
tccggctccaaggtcaagtggattctggaccacgtcgaaggcagccgcgagcgcgcgcgt
aaaggcgagctgatgttcggcaccatcgatacctggctgatctggaaattcactggcggc
aaggttcacgtcaccgactacaccaacgcctcgcggaccatgctgttcaacatccacacg
ctggaatgggatcagcgcatgcttgatgtgctggacatcccgcgcgagatcctgcctgag
gtcaaaagctcttccgaggtctacggtcacagcaagagcggcatcccgattgccggtatt
gcaggcgaccagcaggcagcgctattcggccagatgtgcgtcgaacccggccaggccaaa
aacacctacggcaccggctgcttcctgctgatgaacaccggcaaaaaagccgtgaagtct
gcgcatggcatgctgaccacgattggctgcggcccacgcggcgaagtggcttacgcactc
gaaggcgccgtattcaacggcggttcgaccgtgcagtggctgcgtgacgaactgaagctg
atcaacgacgcgctggacaccgagtacttcgccggcaaggtcaaggacagcaacggcgtg
tacctggtgcctgccttcaccggtctcggcgcgccctactgggacccgtatgcccgcggc
gcactgttcggcctgacccgtggcgtgaaggttgatcacatcatccgcgcggcgctggaa
tccatcgcctatcagacccgtgacgtgctcgacgcgatgcagcaggactcgggcgagcgc
ctcaagtcgctgcgcgtggatggcggcgcggtcgccaacaacttcctgatgcagttccag
gcagacattctcggcactcatgtcgagcgcccgcaaatgcgtgaaacaacggcactgggc
gcagcgttcctggcaggtctggcgattggtttctggagcagcctggacgagttgcgcaac
aaggctgtgatcgagcgcgtgttcgagcctgcttgcgaagaggcgcatcgcgagaagctg
tacgcaggctggcaaaaagccgtcgcgcgcacccgtgactgggaaccgcacgaaaacgaa
gagtga

DBGET integrated database retrieval system