KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4438Help
Entry
PSPTO_4438        CDS       T00118                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00340  Histidine metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    PSPTO_4438 (hisD)
Enzymes [BR:pst01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PSPTO_4438 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 1186119
NCBI-ProteinID: NP_794192
UniProt: Q87WV5
Position
complement(5006428..5007774)
Genome map
AA seq 448 aa AA seqDB search
MTTPTAIRRLDAADPDFARHLDHLLSWESVSDDSVNQRVLDIIKAVRERGDAALVELTQK
FDGLQVASMAELILPRERLELALTRITPVQRQALEKAAERVRSYHEKQKQDSWSYTEADG
TVLGQKVTPLDRAGLYVPGGKASYPSSVLMNAIPAKVAGVTEVVMVVPTPRGEINELVLA
AACIAGVDRVFTIGGAQAVAALAYGTESVPKVDKVVGPGNIYVATAKRHVFGQVGIDMIA
GPSEILVVCDGQTDPDWIAMDLFSQAEHDEDAQAILVSPDAEFLDKVAASITRLLPTMAR
AAIVETSINGRGALIKVADMAQAIEVANRIAPEHLELSVADPEAWLPHIRHAGAIFMGRH
TSEALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIYCSPEGASELGKTASVLARG
ESLSGHARSAEYRITDLDWKTGNLEEGK
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgcccactgcaattcgccgactcgacgctgctgacccggatttcgcgcgccat
ttggatcatctgctgagctgggaaagtgtgtctgacgactcggtcaaccagcgcgtgctc
gacatcatcaaggccgtgcgtgagcgtggcgacgcagcacttgttgaattaactcagaaa
ttcgacggcctgcaggtcgcttcgatggctgagctgatccttccccgcgaacgtctggag
cttgcgttgacgcgcattacgccggttcagcgccaggcactggaaaaagccgccgagcgt
gtgcgcagctaccacgagaagcagaagcaggactcctggagctataccgaggccgacggc
acggtgttgggtcagaaagtcacgccgctggatcgagccggcttgtacgtgcccggcggc
aaggcgtcttacccgtcgtcggtgttgatgaatgccattccggcgaaagtggcgggggtg
accgaggtggtcatggtcgtgccgacgccgcgtggcgaaatcaacgagctggtgttggcg
gcagcctgtatcgccggcgttgaccgtgtgttcaccattgggggcgcgcaggctgtggcg
gccctggcctacggcactgagagcgtaccgaaggtcgataaggtcgtcggccctggcaat
atctatgtcgccacggccaagcgccatgtgttcgggcaggtcggcatcgacatgattgcc
gggccttccgagattctggtggtgtgcgacggccagaccgatcctgactggatcgccatg
gacctgttctcccaggccgagcacgacgaagatgctcaagccattctggtcagcccggac
gccgaattcctcgacaaggttgccgcgagcatcacgcgtttgctgccgaccatggcgcga
gcagccattgtcgaaacatcgatcaatggccgtggtgcgctgatcaaggtggcggacatg
gcgcaagccatcgaagtggccaatcgcattgcgcccgagcacctcgagttgtccgtcgcc
gatcctgaggcctggctgccgcacattcgtcacgccggcgcgatcttcatgggtcgtcac
acctccgaggcgctgggcgactactgcgccggtcccaaccacgtattgccgacctccggt
acggcgcggttttcctcgccattgggcgtttacgacttccagaagcgttcgtcgatcatc
tattgctcgccagagggcgcgtccgaactgggcaagaccgcgtcggtactggcccgtggc
gaatccttgagcggccacgcccgcagcgccgaataccgcatcactgatcttgactggaaa
actggcaaccttgaggaaggcaaataa

DBGET integrated database retrieval system