KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_4494Help
Entry
PSPTO_4494        CDS       T00118                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
pst00010  Glycolysis / Gluconeogenesis
pst00051  Fructose and mannose metabolism
pst00562  Inositol phosphate metabolism
pst01100  Metabolic pathways
pst01110  Biosynthesis of secondary metabolites
pst01120  Microbial metabolism in diverse environments
pst01130  Biosynthesis of antibiotics
pst01200  Carbon metabolism
pst01230  Biosynthesis of amino acids
Module
pst_M00002  Glycolysis, core module involving three-carbon compounds
pst_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_4494 (tpiA)
   00051 Fructose and mannose metabolism
    PSPTO_4494 (tpiA)
   00562 Inositol phosphate metabolism
    PSPTO_4494 (tpiA)
Enzymes [BR:pst01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PSPTO_4494 (tpiA)
Exosome [BR:pst04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PSPTO_4494 (tpiA)
  Exosomal proteins of bladder cancer cells
   PSPTO_4494 (tpiA)
  Exosomal proteins of melanoma cells
   PSPTO_4494 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 1186177
NCBI-ProteinID: NP_794247
UniProt: Q87WQ1
Position
complement(5061980..5062735)
Genome map
AA seq 251 aa AA seqDB search
MRRPMVAGNWKMHGTRASVAELIEGLVKQALPGSVDIAVMPASLFTSRVIEGLQGTSIIV
GAQDAAIQAEQGALTGEIASSQLADAGCKLVLVGHSERRQLIGEQDEVLNKKFAAIQASG
LTPVLCIGETLEERKAGQTLEVVGRQLDSVIAEFGIGALVNAVIAYEPVWAIGTGLTASP
QEAQEVHAAIRAQLAKENAEVAQGVRLLYGGSVKAANAVELFSMPDIDGGLIGGASLNAD
EFGAICRAAGN
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcccaatggtagctggtaactggaaaatgcacggtacccgcgccagcgtcgct
gagctgatcgagggtttggtcaagcaggcgttgcctggcagcgtcgatatcgccgtaatg
cctgcaagcctgtttaccagtcgagtgatcgagggccttcagggtacgtcgatcattgtc
ggtgcgcaggatgcagccattcaggctgagcagggcgcactgaccggcgaaatcgcatcg
agccaattggctgatgccggttgcaagctggtactcgtcgggcactcggagcgtcgtcag
ctgattggcgagcaggatgaggtgctcaacaagaagttcgcagcgatacaggcaagcggt
cttacccctgtgctttgcataggcgagacgcttgaagagcgcaaggcagggcaaacgctt
gaagttgtcgggcgtcagcttgacagcgtcattgcagagtttggtattggtgcgctggtc
aatgcagtaattgcctacgagccagtctgggccatcggcaccggattgaccgcttcgcct
caagaggcgcaggaggtgcacgcagcaattcgtgcgcaactggcaaaagagaatgccgaa
gtcgcacaaggcgtgcgacttctctatggcggcagcgtgaaggcggccaatgcggtcgag
cttttcagcatgccggatatcgatggggggctcattggtggagcgtccctgaatgcagat
gagttcggtgcgatctgtcgcgccgcgggaaactga

DBGET integrated database retrieval system