KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5040Help
Entry
PSPTO_5040        CDS       T00118                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pst00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:pst00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5740872..5741876
Genome map
AA seq 334 aa AA seqDB search
MTPLDAKRPLQLNHQGQLRHFLSLDGLPRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSTSKGETLFDTLRNLEAMAADMFVV
RHADSGAAHFIAEHVCPDVAIINGGDGRHAHPTQGMLDMLTIRRHKGGFENLSVAIVGDI
LHSRVARSNMIALKALGCPDIRVIGPKTLLPVGVEQYGVKVYTDLNEGLKDVDVVIMLRL
QRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDAIVMHPGPINRGVEIESAVADGAHSVI
LNQVTYGIAIRMAVLSMAMSGQNAQRQFEQENAQ
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgacgcctctcgacgccaagcgcccgctgcagctcaaccatcagggccagctgcgccat
tttctgtctctggacggcttgccccgcgagctgctaaccgaaattcttgacaccgccgac
tcgttccttgaagtcggcgcacgggcggtgaagaaggtcccgttgttgcgcggcaagacg
gtgtgcaacgtgttcttcgaaaactccacacgcacccggaccactttcgaactggcggcc
cagcggctgtcggccgacgtgatcaccctgaacgtctcgacttcctctaccagcaagggc
gaaacactgttcgacaccctgcgcaaccttgaagcaatggccgccgacatgttcgtcgtg
cgccacgcagactccggcgctgcgcacttcattgccgagcatgtgtgcccggacgtggcg
atcatcaacggcggtgacggccgacacgcgcacccgacccagggcatgctcgacatgctg
acgattcgtcgtcacaagggtggctttgaaaacctgtcggtggccatcgtcggcgacatc
ctgcactcgcgggtggcgcgctccaacatgattgcactcaaggcgctgggctgcccggac
atccgcgtgatcggcccgaaaaccctgctgccggtcggcgtcgagcaatacggggtcaag
gtctacaccgacctcaacgaaggtttgaaggacgtcgatgtggtgatcatgttgcgcctg
caacgtgagcgcatgaccggtggcctgttgcccagcgaaggcgagttctaccgcttgttc
ggcctgaccaccgcgcgcctggctggcgctaaaccggatgcgattgtgatgcaccccggc
ccgatcaaccgaggcgtggaaatcgaatcggccgtcgccgacggagcacactcggtgatt
ctcaaccaggtgacttacggcatcgcgatccgcatggcagtgctgtcgatggccatgagc
ggacaaaacgcacaacgccaattcgaacaggagaacgcccagtga

DBGET integrated database retrieval system