KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5179Help
Entry
PSPTO_5179        CDS       T00118                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pst00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
5894631..5895629
Genome map
AA seq 332 aa AA seqDB search
MIKNQLARFNRLDLISAPTALEKLERLSLWADRDIYIKRDDTTTLALGGNKVRKLEYLAA
DALAQGADTLITAGAIQSNHVRQTAALAARLGLGCVALLENPIGTEDPSYLKNGNRLLLE
LFDAKVELVENLDNADDQLHALAARLRSSGKKPYLVPIGGSSPVGALGYVRAGLELAEQI
KQTGIDFAAVVLASGSAGTHSGLALALAHELPQLPVVGVTVSRSEEAQLPKVQGLAERTA
QLLDIALPEHFKVELWDEYFAPRYGEPNAGTLAAIKLVASQEGLLLDPVYTGKAMSGLLD
GIGRQRFNDGPLIFLHTGGAPALFAYPDAFDQ
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaatcagcttgcccgcttcaatcgtctggacttgatcagcgcgccaacggcc
ctggaaaagcttgagcgcctgtcgctgtgggcagatcgcgacatctacatcaagcgtgat
gacaccaccacgctcgcgctgggcggcaacaaggtgcgcaagcttgaatacctggccgcc
gatgcgctggctcagggtgccgacacactgatcacggccggcgcaatccagtccaaccat
gtacgccagacggcagccctggcggcgcggctggggctgggctgcgtggccctgctggaa
aaccccatcggcaccgaagacccgagttacctgaaaaacggcaaccgcctgctgctggaa
ctgttcgatgccaaggtcgagctggtcgaaaacctcgataacgccgacgaccagttgcat
gccttggctgcgcgcctgcgctccagcggcaagaagccgtatctggtgcctatcggtggc
tcaagcccggttggtgcactggggtatgtccgcgccgggctggaactcgccgagcagatc
aaacagaccggtatcgactttgcggccgtggtgctggcatcgggcagtgcgggtacgcac
agcggcctggcgttggcgctggctcatgagttgccgcagttgccggtggtcggcgtgacc
gtgtcgcgcagtgaagaagcgcagttgcccaaagtgcaaggcctcgccgagcgcaccgcg
caactgctcgatatcgccctgccggagcacttcaaggtcgaactgtgggacgagtatttc
gccccgcgctacggcgagccaaacgccggtacgctggcagcgatcaaactggtggccagc
caggaaggcctgttgctggacccggtctacaccggcaaggccatgtccggcctgctggac
ggtatcggccgtcaacgcttcaacgacgggccgttgatattcctgcacaccggtggcgcg
cctgcgttgttcgcttatccggatgcgtttgaccagtga

DBGET integrated database retrieval system