KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5397Help
Entry
PSPTO_5397        CDS       T00118                                 

Gene name
rfbC-2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PSPTO_5397 (rfbC-2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PSPTO_5397 (rfbC-2)
Enzymes [BR:pst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     PSPTO_5397 (rfbC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6129606..6130151
Genome map
AA seq 181 aa AA seqDB search
MNVVATQLPEVLILEPKVFGDERGFFYESFNARAFQEATGLTRQFVQDNHSRSQRGVLRG
LHYQIENAQGKLVRVTVGKVLDVAVDIRRSSPNFGRWVGVELSAENARQLWVPEGFAHGF
VVLSEHAEFLYKTTDYYTPSAERCIAWNDPDLAIDWQFDGEPSLSAKDQQGKSLKDADLF
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgtagtagccacacaactgccggaagtcctgattctggagcccaaggtattcggt
gatgaacgaggcttcttctatgaaagcttcaacgcaagggcctttcaggaagccactggc
ctgacccggcagtttgtacaggacaatcactcgcgctcgcaacgaggcgtactgcgcggc
ctgcattatcagatcgaaaacgcgcagggcaagctggtgcgcgtcactgtcggcaaagtg
ctggatgtggctgtggacatccgccgcagttcgccgaacttcgggcggtgggtcggcgtc
gagctgtccgctgaaaacgcccgtcagttgtgggttccggaagggtttgcgcatggtttc
gtggtgctcagcgagcatgccgagttcctttacaagaccaccgactactacacgccttcg
gccgagcgctgtatcgcctggaacgaccctgacctggcgatcgactggcagttcgacggc
gagcccagcctgtcagccaaggatcagcaaggcaaaagcctgaaagacgccgatctgttt
tcctga

DBGET integrated database retrieval system