KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5401Help
Entry
PSPTO_5401        CDS       T00118                                 

Gene name
cysQ
Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:pst00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(6134052..6134861)
Genome map
AA seq 269 aa AA seqDB search
MLAPVIELARLAGEVILPFWRANVTVTTKTDDSPVTAADLAAHQVLVEGLQALDPGIHVL
SEEDADIPLSERASWERWWLVDPLDGTKEFISGSEEFTVNVALIEHGRVVFGVVSMPTNN
RCYFGGAGLGAWRSDDIDHVEPIAVRNQPGDGQTFTVVASRRHTSPQQEHLLAGLANGLG
PLQLTNIGSSLKFCLLAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGAVLQLDGQPFSYP
ARESLLNPFFLALPANAAWRDKLLVLAQS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgccccggtaatagagctggcacgactggccggggaagtgatcctgccgttctgg
cgcgccaacgtcacggtgaccaccaagacggatgactcgccagtgaccgccgccgatctg
gctgcgcaccaggtgctggtcgaaggcttgcaggcacttgatccaggtattcatgtgctc
tccgaagaagacgccgacatcccgctcagcgagcgtgcgagctgggaacgctggtggctg
gtcgacccgctggacggcaccaaggagttcatttcagggagtgaagagttcaccgtcaac
gtcgcgctgatcgagcatggtcgggtggtgttcggtgtggtgtcgatgccgaccaataac
cgctgctacttcggcggtgcaggcctgggcgcgtggcgcagcgatgatatcgatcacgtc
gagccgattgccgtgcgtaatcagccgggtgacgggcagacctttaccgtggtcgccagc
cgccgccacaccagcccgcagcaggaacacctgctggccggtctggcgaacgggctaggg
cctttgcaactgaccaatatcggcagttcgctgaaattctgcctgctggccgaaggcgct
gccgattgctacccaaggcttgccccgacttcgcaatgggacaccgctgcggcgcaaggc
gtgcttgagggcgcgggtggcgcagtcctgcaactggacggccaaccgttcagctacccg
gcacgcgaatcgctgctcaaccccttcttcctcgcgctgcccgccaacgccgcatggcgc
gacaaactgctggtgctggcgcagtcctga

DBGET integrated database retrieval system