KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5490Help
Entry
PSPTO_5490        CDS       T00118                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pst00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PSPTO_5490
Enzymes [BR:pst01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     PSPTO_5490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6256840..6257751
Genome map
AA seq 303 aa AA seqDB search
MPTSPVEPLVESVQYDELNCWRIRHGEAELLVAQQGAHILSYQVAGQPPLVWLNEEAAFK
KGKAIRAGMPICWPWFGNLERNPQSVQAMRDSSEPAKAHGEVRALDWQLLGIGADGDALL
VEFVLPEAEGHLPGWPHNVALKLSIRLDHALNVSLVSYNCGAEPVTFSQALHTYFAVSDV
RQVSIEGLDGLRYIETLANWEEREQTGDLTFTGETDRIYQDTPGVLSIIDPEWQRRIHIR
STGSKSAILWNPWIEKTGTFTDMAADGWQRMVCVETANVLDDVVTLAPDQMHVLGVSIWG
ESL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatccccggttgaacccctcgtcgaatccgtccagtacgatgaactgaactgt
tggcgcattcgccacggcgaagcagagctgctggtcgcccagcaaggcgcacacatcctc
agctatcaggtggccggacaaccgccactggtgtggctgaacgaagaagcggcgttcaag
aaaggcaaagcgatccgtgcgggcatgcccatctgctggccgtggttcggcaatctggag
cgcaaccctcagagcgtgcaggccatgcgcgacagcagcgaacccgccaaggcccacgga
gaagtccgcgcactggactggcaactgctcggtattggcgcagatggcgatgcactgctg
gtagagtttgtcctccccgaagctgaaggccacttgccaggctggccgcacaacgtcgcc
ctgaaactgagcattcgcctggaccacgctctgaacgtcagtctggtcagctataactgc
ggcgcagaaccggtcaccttcagtcaggcgttgcacacctatttcgccgtcagcgatgtt
cgtcaggtcagcatcgaaggactcgacggcctgcgctacatcgaaaccctggcaaactgg
gaagaacgcgaacagaccggcgacctgacgttcaccggcgaaaccgaccgcatctaccag
gacacaccaggcgtgctcagcatcattgaccctgagtggcagcgacgcatccacatccgc
agcaccggctcgaaatcagccatcctgtggaacccgtggatcgagaaaaccggcacattc
accgacatggcagccgacggctggcagcgcatggtctgcgtcgaaaccgccaacgtgctg
gacgacgtggtcacgctggcgcctgaccagatgcatgtgctgggggtgagtatctggggt
gagagtctctga

DBGET integrated database retrieval system