KEGG   Pseudomonas syringae pv. tomato DC3000: PSPTO_5490Help
Entry
PSPTO_5490        CDS       T00118                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pst  Pseudomonas syringae pv. tomato DC3000
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pst00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
6256840..6257751
Genome map
AA seq 303 aa AA seqDB search
MPTSPVEPLVESVQYDELNCWRIRHGEAELLVAQQGAHILSYQVAGQPPLVWLNEEAAFK
KGKAIRAGMPICWPWFGNLERNPQSVQAMRDSSEPAKAHGEVRALDWQLLGIGADGDALL
VEFVLPEAEGHLPGWPHNVALKLSIRLDHALNVSLVSYNCGAEPVTFSQALHTYFAVSDV
RQVSIEGLDGLRYIETLANWEEREQTGDLTFTGETDRIYQDTPGVLSIIDPEWQRRIHIR
STGSKSAILWNPWIEKTGTFTDMAADGWQRMVCVETANVLDDVVTLAPDQMHVLGVSIWG
ESL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccaacatccccggttgaacccctcgtcgaatccgtccagtacgatgaactgaactgt
tggcgcattcgccacggcgaagcagagctgctggtcgcccagcaaggcgcacacatcctc
agctatcaggtggccggacaaccgccactggtgtggctgaacgaagaagcggcgttcaag
aaaggcaaagcgatccgtgcgggcatgcccatctgctggccgtggttcggcaatctggag
cgcaaccctcagagcgtgcaggccatgcgcgacagcagcgaacccgccaaggcccacgga
gaagtccgcgcactggactggcaactgctcggtattggcgcagatggcgatgcactgctg
gtagagtttgtcctccccgaagctgaaggccacttgccaggctggccgcacaacgtcgcc
ctgaaactgagcattcgcctggaccacgctctgaacgtcagtctggtcagctataactgc
ggcgcagaaccggtcaccttcagtcaggcgttgcacacctatttcgccgtcagcgatgtt
cgtcaggtcagcatcgaaggactcgacggcctgcgctacatcgaaaccctggcaaactgg
gaagaacgcgaacagaccggcgacctgacgttcaccggcgaaaccgaccgcatctaccag
gacacaccaggcgtgctcagcatcattgaccctgagtggcagcgacgcatccacatccgc
agcaccggctcgaaatcagccatcctgtggaacccgtggatcgagaaaaccggcacattc
accgacatggcagccgacggctggcagcgcatggtctgcgtcgaaaccgccaacgtgctg
gacgacgtggtcacgctggcgcctgaccagatgcatgtgctgggggtgagtatctggggt
gagagtctctga

DBGET integrated database retrieval system