KEGG   Paenibacillus stellifer: PSTEL_13885Help
Entry
PSTEL_13885       CDS       T03335                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pste  Paenibacillus stellifer
Pathway
pste00071  Fatty acid degradation
pste00280  Valine, leucine and isoleucine degradation
pste00310  Lysine degradation
pste00362  Benzoate degradation
pste00380  Tryptophan metabolism
pste00620  Pyruvate metabolism
pste00630  Glyoxylate and dicarboxylate metabolism
pste00640  Propanoate metabolism
pste00650  Butanoate metabolism
pste00900  Terpenoid backbone biosynthesis
pste01100  Metabolic pathways
pste01110  Biosynthesis of secondary metabolites
pste01120  Microbial metabolism in diverse environments
pste01130  Biosynthesis of antibiotics
pste01200  Carbon metabolism
pste01212  Fatty acid metabolism
pste02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pste00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSTEL_13885
   00630 Glyoxylate and dicarboxylate metabolism
    PSTEL_13885
   00640 Propanoate metabolism
    PSTEL_13885
   00650 Butanoate metabolism
    PSTEL_13885
  Lipid metabolism
   00071 Fatty acid degradation
    PSTEL_13885
   00072 Synthesis and degradation of ketone bodies
    PSTEL_13885
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSTEL_13885
   00310 Lysine degradation
    PSTEL_13885
   00380 Tryptophan metabolism
    PSTEL_13885
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSTEL_13885
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSTEL_13885
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSTEL_13885
Enzymes [BR:pste01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSTEL_13885
Exosome [BR:pste04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSTEL_13885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIQ64017
UniProt: A0A089LSZ4
Position
2897379..2898554
Genome map
AA seq 391 aa AA seqDB search
MENVVIVAAARSAIGAFGGVISEASATTLGSAVIRGLMERSGLKAGEIDEVILGNVLTAG
CGQNPARQSSYEAGLPYQSCAYTINKVCGSGLKAIQLGVQAICCQDADIVIAGGQENMDM
AAHILNKSRKGQRMGNWELVDSLIQDGLCDAFGNYHMGITAENIAEKFGISRTEQDEFAV
NSQAKANEAIQNERFAREIIPIQIEKRGTVHSFDKDEFPRPGTSLEVLSRLKPAFKENGT
VTAGNSSGINNGAAAVLLMSEKKAHELGLKPLARIAGYANVGVDPSLMGTGPIMASKKAL
SRAGWEVQELDLIESNEAFAAQAIAVNREMQWDTDKVNVNGGAIALGHPIGASGARIVVT
LLHEMLRRDARKGLATLCIGGGMGAAMLLER
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgttgttatcgttgcggcggcgcggtcagcgattggagcatttggcggggta
atctctgaagcatcagcgaccacccttggaagtgcagttatcagaggacttatggagaga
agcggccttaaggctggtgaaattgatgaagttattttaggcaatgtgctcacagcggga
tgcgggcaaaatccggccaggcaatcgtcttacgaggccggtcttccgtatcaatcatgc
gcctatacgatcaacaaagtgtgcggttcggggttaaaggccattcaattgggtgtacaa
gctatatgctgccaggatgcggacattgttatcgcaggaggacaggagaatatggatatg
gccgcgcacatcctgaataagtcccggaagggccaacggatgggcaactgggagcttgta
gacagtctgattcaggatggcttatgcgatgcatttggcaactatcatatgggaatcact
gcggagaatatcgcggagaagttcgggatctcccgcacggagcaggacgaatttgccgtc
aattcacaggctaaagcgaatgaagcaattcaaaatgaacggttcgccagagagattatt
ccgattcagattgaaaaaagaggtactgttcattcttttgataaagatgaatttccacgg
ccgggcacaagcttggaggtgctatccaggttgaagccggcattcaaagagaacggcacg
gttactgctggtaattcctccggtattaacaatggagccgctgccgtcctgttaatgagc
gagaagaaagcgcatgaactgggtctcaagcctttggcaagaattgcgggatacgccaat
gtcggtgtggacccttcattaatgggcacaggtccgattatggccagcaagaaggcactg
tcccgggcagggtgggaagttcaggagctggatttgatcgaatcgaatgaagcttttgcg
gctcaagccatcgcggtcaaccgggagatgcaatgggataccgataaagtaaatgtcaac
ggcggcgcgatagcacttggccatccgattggcgcttccggggcacgaatcgttgtcacc
ctgctgcatgagatgctgcggcgcgatgcccgaaaaggtctggcgaccttatgcatcggc
ggcgggatgggagctgcaatgctgctcgaaagatag

DBGET integrated database retrieval system