KEGG   Plautia stali symbiont: E05_23200Help
Entry
E05_23200         CDS       T03051                                 

Definition
4-aminobutyrate aminotransferase
Orthology
K00823  
4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
psts  Plautia stali symbiont
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psts00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    E05_23200
   00650 Butanoate metabolism
    E05_23200
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    E05_23200
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    E05_23200
Enzymes [BR:psts01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     E05_23200
Amino acid related enzymes [BR:psts01007]
 Aminotransferase (transaminase)
  Class III
   E05_23200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1867340..1868599)
Genome map
AA seq 419 aa AA seqDB search
MSNSDVHSRRIQATPRGVGVMCDFFAAKAENAMLWDQQGREYIDFAAGIAVLNTGHRHPK
VLAAVQQQLTCFTHTAFQIVPYENYIHLAERLNALVPIESAVKTTFFSTGAEAVENAMKI
ARAATGRPGIIAFSGAFHGRINMTMALTGKVLPYKTVFGPFASPVFHARYPNALHNVSVH
DALDSLETIFRSDIAPQQVAAIIFEPVQGEGGFYVAPPEFVTALRQLCDRHGILLIADEV
QSGFARTGRLFASEYYDVQPDLITLAKSLAGGFPLSAVSGRAAVMDAPEPGGLGGTYAGH
PPAIAAAHAVLDIISEENLCARAQWLGTQLAEALNGAGCRALAEVRGYGSMMAAEFHDAS
GRPSAEIAKAIQQQALVEGLILLTCGVHSNVIRFLYPLTIPDAQFSTALNILTRILSQH
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacagtgatgtgcacagccgtcggatacaggccacgccgcgtggcgtgggcgtg
atgtgtgatttctttgcggcgaaagccgaaaacgccatgctgtgggaccagcaggggcgc
gaatatattgatttcgccgccggcattgcggtgctcaataccggacaccggcatcccaaa
gtgctggcggcggtacaacagcagctgacatgcttcacccataccgcgtttcaaatcgtg
ccgtatgagaactacatccaccttgcggagcgtctgaatgcgctggtgccgattgagagc
gccgtaaaaaccaccttcttctctaccggcgccgaggcggtcgagaacgcgatgaaaatc
gcgcgcgcagccaccggtcgtccggggattatcgccttcagcggcgcgttccacggccgc
atcaacatgaccatggcgctgaccggcaaagtgctgccttacaaaaccgtcttcggcccg
tttgccagcccggtgtttcacgcacgctaccccaatgcgctgcataacgtcagcgtgcac
gatgcgctcgacagtctggagacgattttccgcagcgatatcgcgccacagcaggtggcg
gccataatctttgaaccggttcagggcgaaggcggattttatgtcgcgccgccagagttt
gtgacggcgctgcgtcagctgtgcgatcgccacggcatcctgctgatcgccgatgaagta
caaagcggttttgcgcgcaccggcaggctgtttgccagcgaatattatgacgtgcagcca
gatctgatcacgctggcgaaaagtctggcaggcgggtttccgctgtcggcggtgagcggc
cgggccgcggtgatggatgcaccggagccgggcggtctgggcggcacttatgctggccat
ccgccagcgattgccgccgcgcatgcggtactggatattatcagcgaggaaaacctgtgc
gcacgtgcgcaatggctcggtacgcaactggcggaagcgttgaacggcgccggctgccgt
gcgctggccgaggtgcgcggctatggctcgatgatggcggcggagttccatgacgccagc
ggccggccctcggcggagatcgccaaagcgattcagcagcaggcgctggtcgaaggattg
attctgctgacctgcggcgtgcacagcaacgtgatccgctttctttatccgttaaccatt
cccgacgcccagttcagtacggcgctgaacattctcacccgcattctcagccagcattaa

DBGET integrated database retrieval system