KEGG   Plautia stali symbiont: E05_34120Help
Entry
E05_34120         CDS       T03051                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
psts  Plautia stali symbiont
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psts00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    E05_34120
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    E05_34120
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    E05_34120
Enzymes [BR:psts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     E05_34120
Exosome [BR:psts04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   E05_34120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2734626..2736032
Genome map
AA seq 468 aa AA seqDB search
MKSLPLFTLSLLASLTTTSALAESASYQRAAIGDITQHGGARRLSGDQTEALKASLSNST
AKNVILLIGDGMGDSEITAARNQAMGAGGFFPGIDALPLTGQYTHYSLDKKTHKPNYVTD
SAVSATAWAIGTKTYNGAIGVDVNGRDQVTLLELAKAAGKATGNVSTAELQDATPAALMA
HVTSRKCYGPEKNTELCPGNALEQGGKGSISEQMLQTRPDVTLGGGAKSFTERAKAGDYQ
GKTLREQAEVRGFQLVDNLAALNAVQQANQQTPLLGLFSDGNMPVRWQGPKASYHGNLDK
PVVTCEVNKDRPASMPTLAQMTQKAIDLLSHNSNGFFLQVEGASIDKQDHAANPCGQIGE
TVDLDEAVQVALAYAREHGDTLVVVTADHAHSSQIVENGTKAPGLTQALNTKDGAVMTIS
YGNSEEDSQEHTGTQLRIAAYGPHAANVVGLTDQTDLFFTLKQAMALK
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcttacctctttttacgctctctctgctggcttcactgaccaccacgtccgcg
ctggcagagagcgccagctatcaacgcgccgccattggcgatattacccagcacggcggc
gcgcgtcgcctgagcggcgaccagaccgaagcgctgaaagcctcattgagcaatagcacg
gcgaagaatgtcatcctgctgattggcgatggcatgggcgattccgaaatcaccgcggcg
cgcaatcaggcgatgggggccggcggcttctttcccggtattgatgcgctgccgctcacc
ggccagtacacccattactcgctggacaagaaaacgcacaagccaaactacgtaacggat
tctgccgtgtcggccacggcttgggccatcggcacgaaaacctataacggcgcgattggc
gtcgatgtcaacggtagggatcaggtcacgctgcttgagctggcgaaagcagcaggtaaa
gccactggcaacgtctccaccgcagaactgcaggatgccacgccggccgcgctgatggcg
cacgtcacctcgcgcaaatgctacggcccggaaaaaaacactgagctgtgtccgggcaac
gcgctggagcagggcggcaaaggatcgatcagcgagcagatgctgcaaactcgtcccgac
gtcacgctgggcggcggtgccaaatctttcactgagcgggctaaagcgggtgactatcag
ggcaaaaccctgcgcgagcaggctgaagtacggggatttcagctggtcgataatctcgcc
gcgctaaacgcggtacagcaggcgaatcaacagacgccactgctggggctgttctcggat
ggcaacatgccggtgcgctggcaggggccaaaagccagctatcacggcaatctggataaa
ccggtggtgacctgtgaggtcaacaaagatcgtccggcatcgatgccaaccctggcacag
atgacgcaaaaagccatcgacctgctcagccacaacagtaatggcttcttcctgcaggtg
gagggcgcgtcgatcgataagcaggatcacgccgctaacccgtgcggtcagattggtgaa
accgtcgatttagatgaggcggtgcaggtggcgctggcgtatgcgcgcgagcacggcgat
acgctggtggtggtaaccgccgatcacgcgcacagcagccagatcgtcgaaaacggcact
aaagcgccgggtctgactcaggcgctcaacaccaaagatggcgcggtgatgaccatcagc
tacggtaactcggaagaggattcacaggagcacaccggcacccagctgcgcatcgcggcc
tacggtccgcacgcggcgaatgtggtcggcctgaccgatcagaccgacctgttcttcacg
ttgaagcaggcgatggcgctgaagtaa

DBGET integrated database retrieval system