KEGG   Pseudoxanthomonas suwonensis: Psesu_0060Help
Entry
Psesu_0060        CDS       T01403                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Psesu_0060
Enzymes [BR:psu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Psesu_0060
    3.5.1.-  
     Psesu_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(70782..71402)
Genome map
AA seq 206 aa AA seqDB search
MLPDTTALIVVDLQPDFMPGGALPCHEGDAIVPAIDALLRARRYRTVLATQDWHPPGHAS
FASAYPGRRPFEQIELHGQPQTLWPDHCVQGTPGAALDPRVDWSAADLVLRKGTRAQVDS
YSGFRENHGPDGQRPPTGLAGWLRERGIGEVHVCGLARDYCVLWTAQDALAAGFRVRFLW
DLTRPVTPDGDAPTRAALEAAGIVVG
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgctgcctgacaccaccgccctgatcgtcgtcgacctgcagccggacttcatgcccggc
ggcgcgctgccctgccacgagggcgatgccatcgtcccggccatcgacgcgctgctgcgc
gcgcgccgctaccgcaccgtgctcgccacccaggactggcatccgcccggccacgcctct
ttcgccagcgcctatcccggccgccggccgttcgagcagatcgaactccacggccagccg
cagaccctgtggccggaccactgcgtgcagggcacgccgggtgcggcgctggacccgcgg
gtggactggagcgccgccgacctggtactgcgcaagggaacccgcgcgcaggtggattcc
tacagcggcttccgcgagaaccacgggccggacggccagcgcccgcccaccggcctggcc
ggctggctgcgcgagcgcggcatcggggaggtccatgtctgcggcctggcccgcgactac
tgcgtgctgtggaccgcgcaggacgcgctggctgccggcttccgcgtgcgcttcctgtgg
gacctgacccggccggtgaccccggacggcgacgcgccgacccgcgcggccctggaggcg
gccggcatcgtcgtcggctga

DBGET integrated database retrieval system