KEGG   Pseudoxanthomonas suwonensis: Psesu_0109Help
Entry
Psesu_0109        CDS       T01403                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
psu  Pseudoxanthomonas suwonensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
125414..126454
Genome map
AA seq 346 aa AA seqDB search
MHAAAPSNRRRRASTHGLRLALGLGLAGVVLAAMPWLASGAAGTAAPVDAGGVAALRIAL
GERLFFEPLLSSDRSVSCASCHKPEYAFADNVPLSRGVAGRLGRRNTPAVLNTAARTSMF
WDGRAETLEEQAIFPIENPVEMDLPVAQALERLNADPGYREAFQAAYGGPATARSLGRAL
AAYQKTLESGDSPYDRYARGDDLAISESARRGRMLFIGKGKCADCHSGEDFTSDRFRNIG
LFNGSALSDRGRGEVTGNPADDGQFKVPSLRNVAVTAPYMHNGMFATLREVLDYYNDPDR
IVPDAHGRDATMPGSLGLAPQDLDDLEAFLVALTDERYAPLLDARR
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccgccgccccctcgaaccgccgccggcgtgcatccacgcatggattgcgcctg
gccctggggctcggcctggccggcgtggtgctggcggcgatgccctggctggcttcgggc
gccgccggcaccgccgccccggtggatgccggcggcgtggccgcgctgcggatcgcgctg
ggcgagcgcctgttcttcgagccgctgctgtcctccgaccgcagcgtcagctgtgcgtcc
tgccacaagcccgagtacgccttcgccgacaacgtgccgctgagccgcggcgtcgccggg
cgactgggccggcgcaacacccccgccgtgctcaataccgccgcgcgcacctcgatgttc
tgggacggccgcgccgagaccctggaggagcaggcgatcttcccgatcgagaacccggtg
gagatggacctgcctgtcgcgcaggcgctggagcggctcaacgccgatcccggctaccgc
gaggccttccaggccgcctacggcggaccggccaccgcgcgcagcctgggccgcgccctg
gccgcctaccagaagacgctggaatcgggcgattcgccctacgaccgctacgcgcgcggc
gacgacctggcgatcagcgagtccgcgcggcgcggacgcatgctgttcatcggcaagggc
aagtgcgccgactgccattccggcgaggacttcacctccgaccgtttccgcaacatcggc
ctgttcaacggcagcgcgctgtccgaccgcggccgcggcgaggtcaccggcaacccggcc
gacgacggccagttcaaggtgccctcgctgcgcaacgtcgcggtgaccgcgccgtacatg
cacaacggcatgttcgccaccctgcgcgaggtgctggactactacaacgatccggaccgg
atcgtgcccgacgcgcacggccgcgatgccacgatgcccggctcgctgggcctggccccg
caggacctcgacgacctcgaggccttcctggtggcgctgaccgacgagcgttacgcgccg
ctgctggatgcacgtcgatga

DBGET integrated database retrieval system