KEGG   Pseudoxanthomonas suwonensis: Psesu_0131Help
Entry
Psesu_0131        CDS       T01403                                 

Definition
pseudouridine synthase
Orthology
K06175  
tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
psu  Pseudoxanthomonas suwonensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
150388..151209
Genome map
AA seq 273 aa AA seqDB search
MQPPERATAGRRRPLRAGCGKTRRPADNARVNEQLPGSLPVLHADQWLAVVDKPAGLMVH
DSVLAADETDFAADRLRAQFGRQVFLVHRLDRATSGCLLLAFDRDTASALGKAVMAQQLD
KRYLAVCRGWPEEGFTIDHPLDGGPGKPQKKPAVTRFRRLACGELDEPSAGFPTSRYALL
ECAPVTGRFRQIRRHLKHASHHLIGDTSHGDGRHNRAFRMRGVHRMLLHAWQLGFPHPKD
GQEMTVVAPPSGEFLKAMALFGWSLADGAAGGG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgccggaacgcgccacggccggccgccgtcgcccgctccgggccgggtgcggc
aaaacccgccgacccgcggataatgcgcgggtgaacgaacaactccccggatcccttccc
gtcctccacgccgaccaatggctggccgtggtcgacaagcccgccggcctgatggtccac
gacagcgtgctggcggccgacgagaccgactttgccgccgaccggctgcgcgcccagttc
ggccgccaggtgttcctggtccaccgcctggaccgcgccaccagtggctgcctgctgctg
gcgttcgaccgcgacaccgcctcggcgctcggcaaggcggtgatggcccagcagctggac
aagcgctacctggcggtgtgccgcggctggcccgaggaagggttcaccatcgaccatccg
ctggatggcggccccggcaagccgcagaagaagccggcggtgacccgcttccggcgcctg
gcctgcggcgagctggacgagccctcggccggattcccgacctcgcgctacgcactgctg
gaatgcgcgccggtgaccgggcgcttccgccagatccggcgccacctcaagcacgcctcg
caccacctgatcggcgacaccagccatggcgacggccgccacaaccgcgccttccgcatg
cgcggcgtgcaccggatgctgctgcacgcctggcagctgggttttccgcacccgaaggac
gggcaggagatgacggtcgtggcgccgccctccggcgagttcctcaaggccatggcgctg
ttcggctggagcctggcggacggcgccgccggcggcggctga

DBGET integrated database retrieval system