KEGG   Pseudoxanthomonas suwonensis: Psesu_0138Help
Entry
Psesu_0138        CDS       T01403                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_0138
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psesu_0138
   00630 Glyoxylate and dicarboxylate metabolism
    Psesu_0138
Enzymes [BR:psu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psesu_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
156001..157689
Genome map
AA seq 562 aa AA seqDB search
MSAAAESAIPASPAPGPRPIPAVVPKGAAGLSLTERVAGQEQLLPAPLLGLLVTLHRAIE
PERRALLAARRERQAFYDAGGLPDFRDDTRAIREGDWKVAPIPQALQDRRVEITGPVDPK
MVINALNSGAHCYMADFEDSTAPTWRNLLAGQGALAGAVEGSLAFEAGNGKQYRLRPYEE
RAVLIVRPRGWHLDEKHVRVDGEPIAGGLFDMAVFAYHNARTLMANDRGPYFYLPKLQSM
EEAALWETALSHVEAFLGLPHGQMKATVLVETLPAVFEMDEILHALRDRIVGLNCGRWDY
IFSYLKTFRAHADKVLPERGQVTMTQPFLKAYSELLIRTCHRRGAHAMGGMAAQIPNASD
PVANEQALARVRADKLREVTAGHDGTWVAHPALIPVAREMFDAHMPTPNQHHVLREDVQV
SRDDLIRPCEGTITREGFENNVEVCVRYLAAWLDGNGCVPIHGMMEDAATAEIARAQLWQ
WLHHSDPRGRHADGSPVHLADGTVVDFALFERTLAALPGRLGDTAGLPGGNRIAEATALL
DELTRACQLVEFLTLPAYARLD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgccgaaagtgccattcccgcctctcccgccccgggcccgcgcccgatc
ccggccgtcgtccccaagggcgccgccgggctttcgctgaccgagcgggtcgcaggccag
gaacagctgcttccggcgccgctgctgggcctgctggtgacgctgcaccgggcgatcgag
ccggagcgccgcgccctgctcgccgctcgccgcgagcgccaggcgttctacgacgccggc
ggcctgcctgacttccgcgacgacacccgcgccatccgcgagggcgactggaaggtcgcg
ccgatcccgcaggcgctgcaggaccgccgggtggagatcactggcccggtcgacccgaag
atggtgatcaacgcgctgaactccggcgcgcactgctacatggccgacttcgaggattcg
accgcaccgacctggcgcaacctgctggccggccagggcgccctggccggcgcggtggaa
ggctcgctggccttcgaggccgggaacggcaagcagtaccgcctgcgtccgtacgaggag
cgagccgtgctgatcgtgcgtccgcgcggctggcacctggacgagaagcacgtgcgcgtg
gacggcgagccgatcgccggcggcctgttcgacatggcggtgttcgcgtaccacaacgcc
cgcaccctgatggccaacgaccgcgggccgtacttctacctgcccaagctgcagtcgatg
gaggaagcggcgctgtgggagaccgcgctgtcccacgtcgaggccttcctgggcctgccg
cacgggcagatgaaggccaccgtcctggtcgagaccctgccggcggtgttcgagatggac
gagatcctgcacgcgctgcgcgaccggatcgtcggcctgaactgcgggcgctgggactac
atcttctcgtacctgaagaccttccgcgcccatgccgacaaggtgttgccggagcgtggc
caggtgaccatgacccagccgttcctgaaggcgtattcggaactgctgatccgcacctgc
caccgccgcggcgcccacgccatgggcggcatggcggcgcagatccccaatgcctccgac
ccggtggccaacgagcaggcgctggcccgcgtgcgcgccgacaagctgcgcgaggtcacc
gccggccacgacggcacctgggtcgcgcatccggcgctgatcccggtggcgcgcgagatg
ttcgacgcgcacatgccgaccccgaaccagcaccacgtgctgcgcgaggacgtgcaggtc
agccgcgacgacctgatccgtccgtgcgagggcacgatcacccgcgagggcttcgagaac
aacgtcgaggtctgcgtgcgctacctggccgcatggctggacggcaacggctgcgtcccg
atccacgggatgatggaggacgcggccaccgccgagatcgcccgcgcccagctgtggcaa
tggctgcaccactccgatccgcgcggccgccacgccgacggcagcccggtgcacctggcc
gacggcacggtggtcgacttcgccctgttcgaacgcaccctggccgcgctgcccgggcgc
ctgggcgacaccgccggcctgcctggcggcaaccgcatcgccgaggcgaccgcgctgctg
gacgagctgacccgcgcctgccagctggtcgagttcctgaccctgcccgcctacgcccgc
ctcgactga

DBGET integrated database retrieval system