KEGG   Pseudoxanthomonas suwonensis: Psesu_0138Help
Entry
Psesu_0138        CDS       T01403                                 

Definition
malate synthase A (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_0138
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psesu_0138
   00630 Glyoxylate and dicarboxylate metabolism
    Psesu_0138
Enzymes [BR:psu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Psesu_0138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
156001..157689
Genome map
AA seq 562 aa AA seqDB search
MSAAAESAIPASPAPGPRPIPAVVPKGAAGLSLTERVAGQEQLLPAPLLGLLVTLHRAIE
PERRALLAARRERQAFYDAGGLPDFRDDTRAIREGDWKVAPIPQALQDRRVEITGPVDPK
MVINALNSGAHCYMADFEDSTAPTWRNLLAGQGALAGAVEGSLAFEAGNGKQYRLRPYEE
RAVLIVRPRGWHLDEKHVRVDGEPIAGGLFDMAVFAYHNARTLMANDRGPYFYLPKLQSM
EEAALWETALSHVEAFLGLPHGQMKATVLVETLPAVFEMDEILHALRDRIVGLNCGRWDY
IFSYLKTFRAHADKVLPERGQVTMTQPFLKAYSELLIRTCHRRGAHAMGGMAAQIPNASD
PVANEQALARVRADKLREVTAGHDGTWVAHPALIPVAREMFDAHMPTPNQHHVLREDVQV
SRDDLIRPCEGTITREGFENNVEVCVRYLAAWLDGNGCVPIHGMMEDAATAEIARAQLWQ
WLHHSDPRGRHADGSPVHLADGTVVDFALFERTLAALPGRLGDTAGLPGGNRIAEATALL
DELTRACQLVEFLTLPAYARLD
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgccgaaagtgccattcccgcctctcccgccccgggcccgcgcccgatc
ccggccgtcgtccccaagggcgccgccgggctttcgctgaccgagcgggtcgcaggccag
gaacagctgcttccggcgccgctgctgggcctgctggtgacgctgcaccgggcgatcgag
ccggagcgccgcgccctgctcgccgctcgccgcgagcgccaggcgttctacgacgccggc
ggcctgcctgacttccgcgacgacacccgcgccatccgcgagggcgactggaaggtcgcg
ccgatcccgcaggcgctgcaggaccgccgggtggagatcactggcccggtcgacccgaag
atggtgatcaacgcgctgaactccggcgcgcactgctacatggccgacttcgaggattcg
accgcaccgacctggcgcaacctgctggccggccagggcgccctggccggcgcggtggaa
ggctcgctggccttcgaggccgggaacggcaagcagtaccgcctgcgtccgtacgaggag
cgagccgtgctgatcgtgcgtccgcgcggctggcacctggacgagaagcacgtgcgcgtg
gacggcgagccgatcgccggcggcctgttcgacatggcggtgttcgcgtaccacaacgcc
cgcaccctgatggccaacgaccgcgggccgtacttctacctgcccaagctgcagtcgatg
gaggaagcggcgctgtgggagaccgcgctgtcccacgtcgaggccttcctgggcctgccg
cacgggcagatgaaggccaccgtcctggtcgagaccctgccggcggtgttcgagatggac
gagatcctgcacgcgctgcgcgaccggatcgtcggcctgaactgcgggcgctgggactac
atcttctcgtacctgaagaccttccgcgcccatgccgacaaggtgttgccggagcgtggc
caggtgaccatgacccagccgttcctgaaggcgtattcggaactgctgatccgcacctgc
caccgccgcggcgcccacgccatgggcggcatggcggcgcagatccccaatgcctccgac
ccggtggccaacgagcaggcgctggcccgcgtgcgcgccgacaagctgcgcgaggtcacc
gccggccacgacggcacctgggtcgcgcatccggcgctgatcccggtggcgcgcgagatg
ttcgacgcgcacatgccgaccccgaaccagcaccacgtgctgcgcgaggacgtgcaggtc
agccgcgacgacctgatccgtccgtgcgagggcacgatcacccgcgagggcttcgagaac
aacgtcgaggtctgcgtgcgctacctggccgcatggctggacggcaacggctgcgtcccg
atccacgggatgatggaggacgcggccaccgccgagatcgcccgcgcccagctgtggcaa
tggctgcaccactccgatccgcgcggccgccacgccgacggcagcccggtgcacctggcc
gacggcacggtggtcgacttcgccctgttcgaacgcaccctggccgcgctgcccgggcgc
ctgggcgacaccgccggcctgcctggcggcaaccgcatcgccgaggcgaccgcgctgctg
gacgagctgacccgcgcctgccagctggtcgagttcctgaccctgcccgcctacgcccgc
ctcgactga

DBGET integrated database retrieval system