KEGG   Pseudoxanthomonas suwonensis: Psesu_0207Help
Entry
Psesu_0207        CDS       T01403                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_0207
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_0207
   00052 Galactose metabolism
    Psesu_0207
   00500 Starch and sucrose metabolism
    Psesu_0207
   00520 Amino sugar and nucleotide sugar metabolism
    Psesu_0207
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Psesu_0207
   00524 Butirosin and neomycin biosynthesis
    Psesu_0207
Enzymes [BR:psu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Psesu_0207
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(230859..231872)
Genome map
AA seq 337 aa AA seqDB search
MTVPTLTRTAPFIAADVGGTHVRMSLVAVDGEGDTPQVLAYSKFRCSDYASLADILREFI
ASLGRHPVAVAVIASAGYPLADGTVITNNLPWPLSPKELRDGLGLQAVHVINDFEAVANA
VSHLGSSEVQLLGGPAQAAPGPLLVLGPGTGLGAAVWIPRDKGGVVLATEAGQAALAVGT
ELEMQLLQHMLGQRSHVPIEHALSGPGLLHLYQALCALRGAAPVHARPGDVTTAAIDGDD
PLAREALEVFCGLLGSAVGDMALLYGVQGVYLAGGILPQMRGFLAGSSFRARFLNKGSMR
EALERVSVKLVEHGQLGVIGAASWYLGSISSKEARLD
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtaccaaccctcacccgcaccgcgccgttcatcgccgccgacgtcggcggcacc
cacgtgcgcatgagcctggttgccgtcgacggcgaaggcgacacgccgcaggtgctggcc
tacagcaagttccgttgctcggactacgccagcctcgccgacatcctgcgcgagttcatc
gcgagcctcggccggcatccggtcgcggtggccgtgatcgccagcgccggctatccgctg
gccgatggcaccgtgatcaccaacaacctgccctggccgctttcgccaaaggaactgcgc
gacggccttggcctgcaggcggtgcacgtgatcaacgacttcgaggcggtggccaatgcg
gtcagccatctcggctccagcgaggtgcagctgctgggtggaccggcgcaggccgcaccc
ggcccgctgctggtgctgggccccggcaccggcctcggcgccgcggtatggattccccgc
gacaagggcggcgtggtgctggccaccgaggccggccaggcggcgctggcggtgggaacg
gaactggagatgcagctgctgcagcacatgctgggccagcgcagccacgtgccgatcgaa
cacgccctgtccgggccgggactgctgcacctgtaccaggcgctgtgcgcgctgcgtggt
gcggcgccggtgcatgcgcggccgggcgacgtcaccaccgcggcgatcgacggcgacgac
ccgctcgcgcgcgaggcgctggaagtgttctgcggcctgctcggaagcgcggtgggcgac
atggccctgctgtacggggtgcagggcgtctacctggccggcgggatcctgccgcagatg
cgcggcttcctggccggcagcagcttccgtgcgcgcttcctcaacaaggggtcgatgcgc
gaggcgctggagcgggtctcggtgaagctcgtcgagcacgggcagctgggcgtcatcggc
gccgccagctggtacctgggatccatttcgtcgaaggaggcgcgactggactga

DBGET integrated database retrieval system