KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0239Help
Entry
Psesu_0239        CDS       T01403                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00010  Glycolysis / Gluconeogenesis
psu00620  Pyruvate metabolism
psu00640  Propanoate metabolism
psu00680  Methane metabolism
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01120  Microbial metabolism in diverse environments
psu01130  Biosynthesis of antibiotics
psu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_0239
   00620 Pyruvate metabolism
    Psesu_0239
   00640 Propanoate metabolism
    Psesu_0239
  Energy metabolism
   00680 Methane metabolism
    Psesu_0239
Enzymes [BR:psu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Psesu_0239
Lipid biosynthesis proteins [BR:psu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Psesu_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADV26101
JGI: Psesu_0239
UniProt: E6WPC8
Position
266530..268473
Genome map
AA seq 647 aa AA seqDB search
MSDLYPVKPEFAASARIGKDEYQRLYRESVEDSEGFWAKAAERLDWFRKPTVIKDVSYDL
DDFRIRWFADGELNVSVNCLDRQLAERGEKVAILFEPDSPDAPVQKVTYRELHERVCRLG
NALRNLGVAKGDRVTIYLPMIPDAVVAMLACARIGAVHSVVFGGFAPNSIADRVIDCGSK
LIITADEGLRGSRKIPLKANVDAALKLPGTNTVETVLVVRHTGGAVDMQAPRDRWFHDVV
DGQPAQCEPERMNAEDPLFILYTSGSTGKPKGVLHTTGGYLLYASYTHEAIFDLREDDIY
WCTADVGWVTGHSYIVYGPLANGATSLVFEGVPNYPSVSRFWEVIDKHQVTIFYTAPTAI
RALMREGEEPVKKTSRSSLRLLGSVGEPINPEAWRWYYDVVGDGRCPVVDTWWQTETGGI
LISPLPGAIDLKPGSATLPFFGVRPALVDADGKVLEGAAEGNLVLLDSWPGQMRTVYGDH
QRFIDTYFRTYPGTYFTGDGCRRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVAHPK
VAEAAVVGFPHDIKGQGIYAYVTLKAGEQPTDELQKELVAWVRKEIGPIATPDHLQWAPG
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVESLVSERKVK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgtaccccgtcaagcccgagttcgccgcgagcgcacgcatcggcaaggac
gaataccagcgcctctaccgcgaatcggtggaggactccgagggcttctgggccaaggcg
gccgagcgtctggactggttccgcaagccgaccgtcatcaaggacgtcagctacgacctg
gacgacttccgcatccgctggttcgccgacggcgagctcaatgtctcggtcaactgcctg
gaccgccagctggccgagcgcggcgaaaaggtcgcgatcctgttcgagccggacagcccg
gacgcgccggtgcagaaggtcacctaccgcgagttgcacgagcgcgtgtgcaggctgggc
aacgcgctgcgcaacctcggcgtggccaagggcgaccgggtcaccatctacctgccgatg
atccccgacgcggtggtggcgatgctcgcctgcgcgcgcatcggcgcggtgcactcggtg
gtgttcggcggcttcgcgcccaattcgatcgccgaccgcgtgatcgactgcggcagcaag
ctgatcatcaccgccgacgagggcctgcgcggttccaggaagatcccgctgaaggcaaac
gtcgacgccgcgctcaagctgcccggcaccaacaccgtggaaaccgtgctggtggtgcgc
cataccggcggcgcggtcgacatgcaggccccgcgcgaccgctggttccacgacgtggtc
gatggccagccggcgcagtgcgagccggagcgcatgaacgccgaggatccgctgttcatc
ctctatacctccggttcgaccggcaagcccaagggcgtgctgcacaccaccggcggctac
ctgctgtacgcgtcctacacccacgaggcgatcttcgacctgcgtgaggacgacatctac
tggtgcaccgcggacgtgggctgggtcaccggccacagctacatcgtctacggcccgctc
gccaacggcgccacctcgctggtgttcgagggggtgcccaactacccgagcgtgtctcgc
ttctgggaagtgatcgacaagcaccaggtcaccatcttctacaccgccccgaccgcgatc
cgcgcgctgatgcgcgagggcgaggagccggtgaagaagaccagccgctccagcctgcgc
ctgctcggcagcgtgggcgagccgatcaaccccgaggcctggcgctggtactacgacgtg
gtcggcgacgggcgctgcccggtggtggacacctggtggcagaccgagaccggcggcatc
ctgatctcgccgctgcccggcgccatcgacctcaagcccggctcggcgaccctgccgttc
ttcggcgtgcgcccggccctggtcgacgccgacggcaaggtcctggagggcgcggccgag
ggcaacctggtgctgctggattcctggccggggcagatgcgcacggtgtatggcgaccac
cagcgcttcatcgacacctatttccgcacctacccgggtacctacttcaccggcgacggc
tgccgccgcgacgaggacggctattactggatcaccggccgcgtcgacgacgtgatcaac
gtctccggccaccgcatcggcaccgccgaggtggagagcgcgctggtcgcccatccgaag
gtggccgaggccgccgtggtcggcttcccgcacgacatcaagggccagggcatctacgcc
tacgtcaccctgaaggccggcgagcagcccaccgacgagctgcagaaggagctggtggcc
tgggtgcgcaaggagatcggcccgatcgccacccccgaccacctgcagtgggcgccgggc
ctgcccaagacccgctccggcaagatcatgcgccgcatcctgcgcaagatcgccgagaac
gccccggaccagctgggcgacacctcgaccctggccgacccctccgtggtcgagtccctg
gtctccgagcgcaaggtgaagtga

DBGET integrated database retrieval system