KEGG   Pseudoxanthomonas suwonensis: Psesu_0239Help
Entry
Psesu_0239        CDS       T01403                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psu  Pseudoxanthomonas suwonensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Psesu_0239
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psesu_0239
   00620 Pyruvate metabolism
    Psesu_0239
   00640 Propanoate metabolism
    Psesu_0239
  Energy metabolism
   00680 Methane metabolism
    Psesu_0239
Enzymes [BR:psu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Psesu_0239
Lipid biosynthesis proteins [BR:psu01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Psesu_0239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
266530..268473
Genome map
AA seq 647 aa AA seqDB search
MSDLYPVKPEFAASARIGKDEYQRLYRESVEDSEGFWAKAAERLDWFRKPTVIKDVSYDL
DDFRIRWFADGELNVSVNCLDRQLAERGEKVAILFEPDSPDAPVQKVTYRELHERVCRLG
NALRNLGVAKGDRVTIYLPMIPDAVVAMLACARIGAVHSVVFGGFAPNSIADRVIDCGSK
LIITADEGLRGSRKIPLKANVDAALKLPGTNTVETVLVVRHTGGAVDMQAPRDRWFHDVV
DGQPAQCEPERMNAEDPLFILYTSGSTGKPKGVLHTTGGYLLYASYTHEAIFDLREDDIY
WCTADVGWVTGHSYIVYGPLANGATSLVFEGVPNYPSVSRFWEVIDKHQVTIFYTAPTAI
RALMREGEEPVKKTSRSSLRLLGSVGEPINPEAWRWYYDVVGDGRCPVVDTWWQTETGGI
LISPLPGAIDLKPGSATLPFFGVRPALVDADGKVLEGAAEGNLVLLDSWPGQMRTVYGDH
QRFIDTYFRTYPGTYFTGDGCRRDEDGYYWITGRVDDVINVSGHRIGTAEVESALVAHPK
VAEAAVVGFPHDIKGQGIYAYVTLKAGEQPTDELQKELVAWVRKEIGPIATPDHLQWAPG
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVESLVSERKVK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacctgtaccccgtcaagcccgagttcgccgcgagcgcacgcatcggcaaggac
gaataccagcgcctctaccgcgaatcggtggaggactccgagggcttctgggccaaggcg
gccgagcgtctggactggttccgcaagccgaccgtcatcaaggacgtcagctacgacctg
gacgacttccgcatccgctggttcgccgacggcgagctcaatgtctcggtcaactgcctg
gaccgccagctggccgagcgcggcgaaaaggtcgcgatcctgttcgagccggacagcccg
gacgcgccggtgcagaaggtcacctaccgcgagttgcacgagcgcgtgtgcaggctgggc
aacgcgctgcgcaacctcggcgtggccaagggcgaccgggtcaccatctacctgccgatg
atccccgacgcggtggtggcgatgctcgcctgcgcgcgcatcggcgcggtgcactcggtg
gtgttcggcggcttcgcgcccaattcgatcgccgaccgcgtgatcgactgcggcagcaag
ctgatcatcaccgccgacgagggcctgcgcggttccaggaagatcccgctgaaggcaaac
gtcgacgccgcgctcaagctgcccggcaccaacaccgtggaaaccgtgctggtggtgcgc
cataccggcggcgcggtcgacatgcaggccccgcgcgaccgctggttccacgacgtggtc
gatggccagccggcgcagtgcgagccggagcgcatgaacgccgaggatccgctgttcatc
ctctatacctccggttcgaccggcaagcccaagggcgtgctgcacaccaccggcggctac
ctgctgtacgcgtcctacacccacgaggcgatcttcgacctgcgtgaggacgacatctac
tggtgcaccgcggacgtgggctgggtcaccggccacagctacatcgtctacggcccgctc
gccaacggcgccacctcgctggtgttcgagggggtgcccaactacccgagcgtgtctcgc
ttctgggaagtgatcgacaagcaccaggtcaccatcttctacaccgccccgaccgcgatc
cgcgcgctgatgcgcgagggcgaggagccggtgaagaagaccagccgctccagcctgcgc
ctgctcggcagcgtgggcgagccgatcaaccccgaggcctggcgctggtactacgacgtg
gtcggcgacgggcgctgcccggtggtggacacctggtggcagaccgagaccggcggcatc
ctgatctcgccgctgcccggcgccatcgacctcaagcccggctcggcgaccctgccgttc
ttcggcgtgcgcccggccctggtcgacgccgacggcaaggtcctggagggcgcggccgag
ggcaacctggtgctgctggattcctggccggggcagatgcgcacggtgtatggcgaccac
cagcgcttcatcgacacctatttccgcacctacccgggtacctacttcaccggcgacggc
tgccgccgcgacgaggacggctattactggatcaccggccgcgtcgacgacgtgatcaac
gtctccggccaccgcatcggcaccgccgaggtggagagcgcgctggtcgcccatccgaag
gtggccgaggccgccgtggtcggcttcccgcacgacatcaagggccagggcatctacgcc
tacgtcaccctgaaggccggcgagcagcccaccgacgagctgcagaaggagctggtggcc
tgggtgcgcaaggagatcggcccgatcgccacccccgaccacctgcagtgggcgccgggc
ctgcccaagacccgctccggcaagatcatgcgccgcatcctgcgcaagatcgccgagaac
gccccggaccagctgggcgacacctcgaccctggccgacccctccgtggtcgagtccctg
gtctccgagcgcaaggtgaagtga

DBGET integrated database retrieval system