KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0325Help
Entry
Psesu_0325        CDS       T01403                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
psu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psu01100  Metabolic pathways
psu01110  Biosynthesis of secondary metabolites
psu01130  Biosynthesis of antibiotics
psu01230  Biosynthesis of amino acids
Module
psu_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psesu_0325
Enzymes [BR:psu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psesu_0325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C DUF1490
Motif
Other DBs
NCBI-ProteinID: ADV26186
JGI: Psesu_0325
UniProt: E6WQ08
Position
355231..356025
Genome map
AA seq 264 aa AA seqDB search
MSDILQTILARKAEEIAERRTRLPLAEVVARARDAGPVRGFAAALQAAIAQGDPAVIAEV
KKASPSKGVIRPDFRPGEIAVSYEFGGASCLSVLTDVDFFQGADEYLQQARAACTLPVLR
KDFTIDPYQVHEARMLGADCILLIVAALDDGQLAELSGTALELGMDVLVEVHDIDELERA
IQVPVPLVGINNRNLRTFEVSLDVTLQMKDAVPRDRLLVTESGILAPPDVALMRQAGVHA
FLVGEAFMRAEEPGEALRQLFFDA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacatcctgcagaccatcctggcccgcaaggccgaagagatcgccgagcgccgc
acgcgcctgccgctggccgaagtggtggcgcgggcgcgcgatgccggccccgtccgtggc
ttcgccgccgcgctgcaggccgccatcgcccagggcgatccggcggtgatcgccgaggtc
aagaaggccagcccgtccaagggcgtgatccgccccgatttccgtcccggggagatcgcg
gtcagctacgagttcggcggcgcctcctgcctgtcggtgctgaccgacgtggacttcttc
cagggcgcggacgagtacctgcagcaggcgcgcgccgcctgcaccctgccggtgctgcgc
aaggacttcaccatcgatccctaccaggtgcacgaggcgcgcatgctcggcgccgactgc
atcctgctgatcgtcgccgcgctggacgatggccagctggccgagctttccggcaccgcg
ctggaactgggcatggacgtgctggtcgaggtccacgacatcgacgagctggaacgcgcg
atccaggtgccggtgccgctggtgggcatcaacaaccgcaacctgcgcaccttcgaggtg
tcgctggacgtgaccctgcagatgaaggacgcggtgccgcgcgaccgcctgctggtcacc
gagagcggcatcctcgcgccgccggacgtggcgctgatgcgccaggccggcgtgcatgcc
ttcctcgtcggcgaggccttcatgcgcgccgaggagccgggcgaggccctgcgccagctg
ttcttcgacgcatga

DBGET integrated database retrieval system