KEGG   Pseudoxanthomonas suwonensis 11-1: Psesu_0328Help
Entry
Psesu_0328        CDS       T01403                                 

Definition
(GenBank) S-adenosylmethionine decarboxylase proenzyme (EC:4.1.1.50)
  KO
K01611  
S-adenosylmethionine decarboxylase [EC:4.1.1.50]
Organism
psu  Pseudoxanthomonas suwonensis 11-1
Pathway
Cysteine and methionine metabolism
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psu00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Psesu_0328
   00330 Arginine and proline metabolism
    Psesu_0328
Enzymes [BR:psu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.50  adenosylmethionine decarboxylase
     Psesu_0328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
357581..358384
Genome map
AA seq 267 aa AA seqDB search
MTAVVKPLPRLRLQGFNNLTKALSFNIYDVCYAVSEDERQRYIEYIDEAYNADRLTQILT
DVARIIGANILNVARQDYDPQGASVTILISEEPVIDKKQAGKEVISDAVVAHMDKSHITV
HTYPETHPQNGIATFRADIDVATCGVISPLKALNYLIESFESDIVVMDYRVRGFTRDVKG
KKHYIDHKINSIQDFLAKNIRSRYEMIDVNVYQENIFHTKMHLKEFDLDTYLFEEKARNL
SFKERMRIEALLKREIEELFHGRNLVE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgtggtcaaaccgctgccgcgcctgaggctgcaaggcttcaacaacctgacc
aaagcgctgagcttcaacatctacgacgtctgttacgcggtctccgaagacgagcgccag
cgctacatcgagtacatcgatgaagcgtacaacgccgaccgcctgacccagatcctgacc
gacgtggcgcggatcatcggcgcgaacatcctcaacgtggcccgccaggactacgacccg
cagggtgcgtccgtcaccatcctcatctccgaggaaccggtgatcgacaagaagcaggcc
ggcaaggaggtcatctccgacgcggtggtcgcgcacatggacaagagccacattaccgtc
catacctacccggaaacgcatccgcagaacggcatcgcgaccttccgcgcggacatcgac
gtggccacctgcggcgtgatctcgccgctgaaggcgctgaactacctgatcgagagcttc
gagtccgacatcgtggtgatggattaccgcgtgcgcggcttcacccgcgacgtgaagggc
aagaagcactacatcgaccacaagatcaactcgatccaggacttcctggccaagaacatc
cgttcgcgctacgagatgatcgacgtgaacgtgtaccaggagaacatcttccacacgaag
atgcacctgaaggagttcgacctcgacacctacctgttcgaggagaaggcccgcaacctc
tcgttcaaggagcgcatgcgcatcgaggcgctgctcaagcgcgagatcgaggaactgttc
cacggccgcaacctggtcgagtaa

DBGET integrated database retrieval system